BLASTX nr result
ID: Achyranthes23_contig00047168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00047168 (260 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006464713.1| PREDICTED: dentin sialophosphoprotein-like [... 88 1e-15 ref|XP_006451934.1| hypothetical protein CICLE_v10007365mg [Citr... 88 1e-15 ref|XP_006348387.1| PREDICTED: microtubule-associated protein fu... 87 2e-15 gb|EOY12861.1| COP1-interacting protein 7, putative isoform 2 [T... 87 3e-15 gb|EOY12860.1| COP1-interacting protein 7, putative isoform 1 [T... 87 3e-15 ref|XP_004244206.1| PREDICTED: uncharacterized protein LOC101248... 85 1e-14 ref|XP_006347084.1| PREDICTED: dentin sialophosphoprotein-like [... 82 1e-13 ref|XP_004232832.1| PREDICTED: uncharacterized protein LOC101263... 82 1e-13 ref|XP_003635544.1| PREDICTED: uncharacterized protein LOC100854... 81 1e-13 emb|CBI38326.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_006413076.1| hypothetical protein EUTSA_v10024285mg [Eutr... 80 2e-13 ref|XP_002317515.2| COP1-interacting protein 7 [Populus trichoca... 80 3e-13 ref|XP_006283049.1| hypothetical protein CARUB_v10004040mg [Caps... 79 5e-13 ref|XP_006283048.1| hypothetical protein CARUB_v10004040mg [Caps... 79 5e-13 ref|XP_002869565.1| cop1-interacting protein 7 [Arabidopsis lyra... 79 5e-13 gb|EXB76315.1| hypothetical protein L484_025673 [Morus notabilis] 79 6e-13 ref|XP_002305012.2| hypothetical protein POPTR_0004s03850g [Popu... 79 8e-13 ref|NP_194473.1| COP1-interacting protein 7 [Arabidopsis thalian... 79 8e-13 dbj|BAA31739.1| COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis ... 79 8e-13 ref|XP_002329150.1| predicted protein [Populus trichocarpa] gi|5... 79 8e-13 >ref|XP_006464713.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis] Length = 1193 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS TRLDY LFQLTPTRTRC+L+IFAG S+EKLA GLLEPF+ HL+SAKD Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIFAGDSSEKLASGLLEPFVLHLKSAKD 51 >ref|XP_006451934.1| hypothetical protein CICLE_v10007365mg [Citrus clementina] gi|557555160|gb|ESR65174.1| hypothetical protein CICLE_v10007365mg [Citrus clementina] Length = 956 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS TRLDY LFQLTPTRTRC+L+IFAG S+EKLA GLLEPF+ HL+SAKD Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIFAGDSSEKLASGLLEPFVLHLKSAKD 51 >ref|XP_006348387.1| PREDICTED: microtubule-associated protein futsch-like [Solanum tuberosum] Length = 1110 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS TRLDY LFQLTPTRTRC+L+IFAG+++EKLA GLLEPF+ HL+SAKD Sbjct: 1 MDSRTRLDYALFQLTPTRTRCDLVIFAGENSEKLASGLLEPFLIHLKSAKD 51 >gb|EOY12861.1| COP1-interacting protein 7, putative isoform 2 [Theobroma cacao] Length = 1147 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLDY LFQLTPTRTRC+L+IFAGK EKLA GLLEPFI HL+SAKD Sbjct: 1 MDFRTRLDYALFQLTPTRTRCDLVIFAGKETEKLASGLLEPFILHLKSAKD 51 >gb|EOY12860.1| COP1-interacting protein 7, putative isoform 1 [Theobroma cacao] gi|508720965|gb|EOY12862.1| COP1-interacting protein 7, putative isoform 1 [Theobroma cacao] Length = 1192 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLDY LFQLTPTRTRC+L+IFAGK EKLA GLLEPFI HL+SAKD Sbjct: 1 MDFRTRLDYALFQLTPTRTRCDLVIFAGKETEKLASGLLEPFILHLKSAKD 51 >ref|XP_004244206.1| PREDICTED: uncharacterized protein LOC101248895 [Solanum lycopersicum] Length = 1105 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS RLDY LFQLTPTRTRC+L+IFAG+ +EKLA GLLEPF+ HL+SAKD Sbjct: 1 MDSRIRLDYALFQLTPTRTRCDLVIFAGEKSEKLASGLLEPFLIHLKSAKD 51 >ref|XP_006347084.1| PREDICTED: dentin sialophosphoprotein-like [Solanum tuberosum] Length = 897 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS T LDY LFQLTPTRTRC+L++F+G NEKLA GL+EPFI+HL+ AKD Sbjct: 1 MDSKTLLDYALFQLTPTRTRCDLVVFSGGKNEKLASGLVEPFISHLKFAKD 51 >ref|XP_004232832.1| PREDICTED: uncharacterized protein LOC101263075 [Solanum lycopersicum] Length = 896 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS T LDY LFQLTPTRTRC+L++F+G NEKLA GL+EPFI+HL+ AKD Sbjct: 1 MDSKTLLDYALFQLTPTRTRCDLVVFSGGKNEKLASGLVEPFISHLKFAKD 51 >ref|XP_003635544.1| PREDICTED: uncharacterized protein LOC100854548 [Vitis vinifera] Length = 997 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS T LDY LFQLTPTRTRC+L+IF+G EKLA GLLEPFI+HL+ AKD Sbjct: 1 MDSRTHLDYALFQLTPTRTRCDLVIFSGAITEKLASGLLEPFISHLKFAKD 51 >emb|CBI38326.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS T LDY LFQLTPTRTRC+L+IF+G EKLA GLLEPFI+HL+ AKD Sbjct: 1 MDSRTHLDYALFQLTPTRTRCDLVIFSGAITEKLASGLLEPFISHLKFAKD 51 >ref|XP_006413076.1| hypothetical protein EUTSA_v10024285mg [Eutrema salsugineum] gi|557114246|gb|ESQ54529.1| hypothetical protein EUTSA_v10024285mg [Eutrema salsugineum] Length = 1067 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLDY LFQLTPTRTRCEL+IF+G NEKLA G+ +PF+ HL+S +D Sbjct: 1 MDPRTRLDYALFQLTPTRTRCELVIFSGGENEKLASGIFQPFVTHLKSVRD 51 >ref|XP_002317515.2| COP1-interacting protein 7 [Populus trichocarpa] gi|550328221|gb|EEE98127.2| COP1-interacting protein 7 [Populus trichocarpa] Length = 1095 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS T LD+ LFQLTPTRTRC+L+I+AG NEKLA GLLEPF+ HL++AKD Sbjct: 1 MDSRTLLDHALFQLTPTRTRCDLVIYAGGVNEKLASGLLEPFLQHLKTAKD 51 >ref|XP_006283049.1| hypothetical protein CARUB_v10004040mg [Capsella rubella] gi|482551754|gb|EOA15947.1| hypothetical protein CARUB_v10004040mg [Capsella rubella] Length = 767 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLDY LFQLTPTRTRCEL+IF G NEKLA G+ +PF+ HL+S +D Sbjct: 1 MDPRTRLDYALFQLTPTRTRCELVIFYGGENEKLASGIFQPFVTHLKSVRD 51 >ref|XP_006283048.1| hypothetical protein CARUB_v10004040mg [Capsella rubella] gi|482551753|gb|EOA15946.1| hypothetical protein CARUB_v10004040mg [Capsella rubella] Length = 1055 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLDY LFQLTPTRTRCEL+IF G NEKLA G+ +PF+ HL+S +D Sbjct: 1 MDPRTRLDYALFQLTPTRTRCELVIFYGGENEKLASGIFQPFVTHLKSVRD 51 >ref|XP_002869565.1| cop1-interacting protein 7 [Arabidopsis lyrata subsp. lyrata] gi|297315401|gb|EFH45824.1| cop1-interacting protein 7 [Arabidopsis lyrata subsp. lyrata] Length = 1056 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLDY LFQLTPTRTRC+L+IF+G NEKLA G+ +PF+ HL+S +D Sbjct: 1 MDPRTRLDYALFQLTPTRTRCDLVIFSGGENEKLASGIFQPFVTHLKSVRD 51 >gb|EXB76315.1| hypothetical protein L484_025673 [Morus notabilis] Length = 1159 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/52 (75%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFA-GKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLD+ LFQLTPTRTRC+L+IFA NEKLA GLLEPF+AHL+SAKD Sbjct: 1 MDPRTRLDHALFQLTPTRTRCDLVIFAVNGGNEKLASGLLEPFLAHLKSAKD 52 >ref|XP_002305012.2| hypothetical protein POPTR_0004s03850g [Populus trichocarpa] gi|550340266|gb|EEE85523.2| hypothetical protein POPTR_0004s03850g [Populus trichocarpa] Length = 931 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS+T LDY LFQLTPTRTRC+L++F G NEKLA GL EPFI HL+ KD Sbjct: 1 MDSSTLLDYALFQLTPTRTRCDLVLFCGGKNEKLASGLFEPFILHLKFIKD 51 >ref|NP_194473.1| COP1-interacting protein 7 [Arabidopsis thaliana] gi|186514102|ref|NP_001119068.1| COP1-interacting protein 7 [Arabidopsis thaliana] gi|3327868|dbj|BAA31738.1| COP1-Interacting Protein 7 (CIP7) [Arabidopsis thaliana] gi|4972068|emb|CAB43875.1| COP1-interacting protein 7 (CIP7) [Arabidopsis thaliana] gi|7269597|emb|CAB81393.1| COP1-interacting protein 7 (CIP7) [Arabidopsis thaliana] gi|332659939|gb|AEE85339.1| COP1-interacting protein 7 [Arabidopsis thaliana] gi|332659940|gb|AEE85340.1| COP1-interacting protein 7 [Arabidopsis thaliana] Length = 1058 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLDY LFQLTPTRTRC+L+IF+G NEKLA G+ +PF+ HL+S D Sbjct: 1 MDPRTRLDYALFQLTPTRTRCDLVIFSGGENEKLASGIFQPFVTHLKSVSD 51 >dbj|BAA31739.1| COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] Length = 235 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MD TRLDY LFQLTPTRTRC+L+IF+G NEKLA G+ +PF+ HL+S D Sbjct: 1 MDPRTRLDYALFQLTPTRTRCDLVIFSGGENEKLASGIFQPFVTHLKSVSD 51 >ref|XP_002329150.1| predicted protein [Populus trichocarpa] gi|566154090|ref|XP_006370300.1| COP1-interacting protein 7 [Populus trichocarpa] gi|550349479|gb|ERP66869.1| COP1-interacting protein 7 [Populus trichocarpa] Length = 1118 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = +2 Query: 107 MDSTTRLDYVLFQLTPTRTRCELIIFAGKSNEKLAYGLLEPFIAHLRSAKD 259 MDS T LD+ LFQLTPTRTRC+L+I+AG NE+LA GLLEPF+ HL++AKD Sbjct: 1 MDSRTFLDHALFQLTPTRTRCDLVIYAGGVNERLASGLLEPFLQHLKTAKD 51