BLASTX nr result
ID: Achyranthes23_contig00046869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046869 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546034.1| PREDICTED: ethylene-responsive transcription... 57 3e-06 >ref|XP_003546034.1| PREDICTED: ethylene-responsive transcription factor WIN1-like [Glycine max] Length = 176 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/63 (50%), Positives = 39/63 (61%), Gaps = 10/63 (15%) Frame = -1 Query: 357 VWQKWNVGGQSNSNWIMTVNFDPNNTNV----------EAQQTKGGITEEEKTALQMIEE 208 VWQK G +S SNWIMTV + +N NV E ++K G+ EE+K ALQMIEE Sbjct: 113 VWQK-RAGPRSESNWIMTVELERSNVNVVSDSQVVSVPEKVESKNGLDEEQKIALQMIEE 171 Query: 207 LLN 199 LLN Sbjct: 172 LLN 174