BLASTX nr result
ID: Achyranthes23_contig00046819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046819 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51258.1|AC025782_3 Ty1/copia-element polyprotein [Arabidop... 72 1e-10 ref|XP_006414770.1| hypothetical protein EUTSA_v10027425mg, part... 63 5e-08 ref|XP_006602561.1| PREDICTED: uncharacterized protein LOC102660... 62 1e-07 ref|XP_003619897.1| hypothetical protein MTR_6g071480 [Medicago ... 61 1e-07 ref|XP_004487728.1| PREDICTED: uncharacterized protein LOC101496... 59 5e-07 emb|CAN79868.1| hypothetical protein VITISV_011481 [Vitis vinifera] 59 5e-07 ref|XP_006415896.1| hypothetical protein EUTSA_v10009346mg, part... 59 7e-07 ref|XP_006392205.1| hypothetical protein EUTSA_v10023972mg, part... 59 9e-07 dbj|BAB08885.1| retroelement pol polyprotein-like [Arabidopsis t... 58 1e-06 ref|XP_006409990.1| hypothetical protein EUTSA_v10017718mg, part... 57 2e-06 ref|XP_004501782.1| PREDICTED: uncharacterized protein LOC101501... 57 3e-06 gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsi... 57 3e-06 gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsi... 57 3e-06 ref|XP_006576053.1| PREDICTED: uncharacterized protein LOC102662... 56 4e-06 ref|XP_006419099.1| hypothetical protein EUTSA_v10003107mg [Eutr... 56 4e-06 ref|XP_003605776.1| hypothetical protein MTR_4g039500 [Medicago ... 56 4e-06 ref|XP_006403356.1| hypothetical protein EUTSA_v10003354mg [Eutr... 55 7e-06 gb|AAG09097.1|AC009323_8 Putative retroelement polyprotein [Arab... 55 7e-06 ref|XP_006397294.1| hypothetical protein EUTSA_v10029485mg [Eutr... 55 1e-05 gb|AAT40486.1| putative polyprotein [Solanum demissum] 55 1e-05 >gb|AAG51258.1|AC025782_3 Ty1/copia-element polyprotein [Arabidopsis thaliana] Length = 1152 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/57 (54%), Positives = 43/57 (75%) Frame = -2 Query: 172 YYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSSPNY 2 YYLHP++ V++P+LL G+NY+ + RNNL+AK KLGFIDGT+ P+S SP+Y Sbjct: 25 YYLHPSDHPHHVLTPMLLNGENYERWAKLTRNNLQAKQKLGFIDGTLTKPSSDSPDY 81 >ref|XP_006414770.1| hypothetical protein EUTSA_v10027425mg, partial [Eutrema salsugineum] gi|557115940|gb|ESQ56223.1| hypothetical protein EUTSA_v10027425mg, partial [Eutrema salsugineum] Length = 224 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = -2 Query: 172 YYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSS 11 YYLHP++ V++PILL G NY+ + + N+LR K K+GF+DGT+ P+ +S Sbjct: 26 YYLHPSDNTGQVLTPILLNGSNYERWAKLMLNSLRTKRKIGFVDGTLKRPSDNS 79 >ref|XP_006602561.1| PREDICTED: uncharacterized protein LOC102660706 [Glycine max] Length = 381 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/65 (46%), Positives = 40/65 (61%) Frame = -2 Query: 208 PPPDSRYEPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIP 29 PP D +P + +++HP++G S+V LL G NY RSLR L AK K F+DGTIP Sbjct: 9 PPADPSTDPTSPFFVHPSDGPSSVKVTPLLDGSNYHSWARSLRRALGAKLKFEFLDGTIP 68 Query: 28 MPASS 14 MP + Sbjct: 69 MPVDA 73 >ref|XP_003619897.1| hypothetical protein MTR_6g071480 [Medicago truncatula] gi|355494912|gb|AES76115.1| hypothetical protein MTR_6g071480 [Medicago truncatula] Length = 133 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/69 (40%), Positives = 40/69 (57%) Frame = -2 Query: 208 PPPDSRYEPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIP 29 PP D +P YY+H ++G S+VI +L NY RS+R L KNK F+DG+IP Sbjct: 20 PPLDPSQQPGNVYYVHSSDGPSSVIVTPVLNNSNYHSWARSMRRALGGKNKFDFVDGSIP 79 Query: 28 MPASSSPNY 2 +P P++ Sbjct: 80 VPMEFDPSF 88 >ref|XP_004487728.1| PREDICTED: uncharacterized protein LOC101496141 [Cicer arietinum] Length = 562 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/74 (36%), Positives = 43/74 (58%) Frame = -2 Query: 223 DSSKTPPPDSRYEPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFI 44 D++ P D P YYLHP E AV+ L +NY ++++ L +KNK+ FI Sbjct: 20 DTASFPEKDPALNPRNPYYLHPGENPGAVLVAPPLNDNNYHNWSKAVKRALSSKNKIQFI 79 Query: 43 DGTIPMPASSSPNY 2 +G++P PAS+ P++ Sbjct: 80 NGSLPQPASTHPDF 93 >emb|CAN79868.1| hypothetical protein VITISV_011481 [Vitis vinifera] Length = 154 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/61 (44%), Positives = 39/61 (63%) Frame = -2 Query: 187 EPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSSP 8 EP + YLHP++ A I+ + G+NYD ++++N LRAKNKLG IDGT+ P + Sbjct: 13 EPSSPLYLHPSDNPGATITTCVFNGENYDMWEKAVKNALRAKNKLGIIDGTVNKPKGENG 72 Query: 7 N 5 N Sbjct: 73 N 73 >ref|XP_006415896.1| hypothetical protein EUTSA_v10009346mg, partial [Eutrema salsugineum] gi|557093667|gb|ESQ34249.1| hypothetical protein EUTSA_v10009346mg, partial [Eutrema salsugineum] Length = 272 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/54 (44%), Positives = 37/54 (68%) Frame = -2 Query: 172 YYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSS 11 YYLH ++ V++PILL G NY+ + + N+LR K K+GF+DGT+ P+ +S Sbjct: 28 YYLHLSDNTGQVLTPILLNGSNYERWAKLMLNSLRTKRKIGFVDGTLKRPSDNS 81 >ref|XP_006392205.1| hypothetical protein EUTSA_v10023972mg, partial [Eutrema salsugineum] gi|557088711|gb|ESQ29491.1| hypothetical protein EUTSA_v10023972mg, partial [Eutrema salsugineum] Length = 198 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = -2 Query: 172 YYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSSPNY 2 YYL ++ V++P+LL GDNY+ + RNNL AK+KLGFIDG++ P++ S +Y Sbjct: 19 YYLSSSDHPHHVLTPMLLNGDNYEMWAKLARNNLVAKHKLGFIDGSLSKPSAESNDY 75 >dbj|BAB08885.1| retroelement pol polyprotein-like [Arabidopsis thaliana] Length = 370 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/68 (41%), Positives = 41/68 (60%) Frame = -2 Query: 205 PPDSRYEPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPM 26 PP + + Y L ++ +I+ ++L GDNY+E + N L+AK K GFIDGTI Sbjct: 19 PPSASSVVQSPYTLSNSDNPGTLITSVVLNGDNYNEWSEEMLNALQAKRKTGFIDGTIQK 78 Query: 25 PASSSPNY 2 PAS SP++ Sbjct: 79 PASDSPDF 86 >ref|XP_006409990.1| hypothetical protein EUTSA_v10017718mg, partial [Eutrema salsugineum] gi|557111159|gb|ESQ51443.1| hypothetical protein EUTSA_v10017718mg, partial [Eutrema salsugineum] Length = 234 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = -2 Query: 175 EYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSS 11 +YYL P + VIS + L+G NY+ + LRN L+AKNKL FIDG + P+S + Sbjct: 4 DYYLPPGADLGQVISTVFLEGPNYERWAKLLRNALKAKNKLCFIDGNVKQPSSGA 58 >ref|XP_004501782.1| PREDICTED: uncharacterized protein LOC101501608 [Cicer arietinum] Length = 362 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/57 (45%), Positives = 38/57 (66%) Frame = -2 Query: 175 EYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSSPN 5 +YY+HPNE S V+ +L+G NY R++ +L+ KNK GF+DG+IP P +PN Sbjct: 17 DYYIHPNENPSLVLVSPILEGPNYHGWARAMAMSLQMKNKFGFVDGSIPCP--DAPN 71 >gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1496 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/65 (44%), Positives = 40/65 (61%) Frame = -2 Query: 211 TPPPDSRYEPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTI 32 T S T Y ++ ++ A+IS ++LK +NY E L+N LRAK KLGFIDG+I Sbjct: 9 TSTSSSNTSSTTAYLINASDNPGALISSVVLKENNYAEWSEELQNFLRAKQKLGFIDGSI 68 Query: 31 PMPAS 17 P PA+ Sbjct: 69 PKPAA 73 >gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1501 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = -2 Query: 172 YYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSSPNY 2 Y L ++ AVIS + L GDNY++ + N L+AK K GFI+GTIP P + PNY Sbjct: 32 YTLASSDNPGAVISSVELNGDNYNQWATEMLNALQAKRKTGFINGTIPRPPPNDPNY 88 >ref|XP_006576053.1| PREDICTED: uncharacterized protein LOC102662412 [Glycine max] Length = 424 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/66 (40%), Positives = 37/66 (56%) Frame = -2 Query: 199 DSRYEPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPA 20 D P YY+HPNE S ++ +L NY CRS++ L +KNK+ F+DGT+ P Sbjct: 7 DFATNPSNPYYMHPNENPSLILVQPVLDNKNYQIWCRSMKVALISKNKVKFVDGTLSPPP 66 Query: 19 SSSPNY 2 S P Y Sbjct: 67 ISDPLY 72 >ref|XP_006419099.1| hypothetical protein EUTSA_v10003107mg [Eutrema salsugineum] gi|557097027|gb|ESQ37535.1| hypothetical protein EUTSA_v10003107mg [Eutrema salsugineum] Length = 189 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/52 (46%), Positives = 37/52 (71%) Frame = -2 Query: 169 YLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASS 14 YLHP++ +I+ + LKG+NY++ + +RN LR K KLGFIDGT+ P ++ Sbjct: 2 YLHPSDRPGDLITTVQLKGENYEDWAKHVRNALRTKRKLGFIDGTLMKPTTA 53 >ref|XP_003605776.1| hypothetical protein MTR_4g039500 [Medicago truncatula] gi|355506831|gb|AES87973.1| hypothetical protein MTR_4g039500 [Medicago truncatula] Length = 137 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = -2 Query: 172 YYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASSSPN 5 +Y+HP+EG ++V LL G NY RS+++ L AKNKL F+DG+IP+P S+ N Sbjct: 19 FYVHPSEGPNSVTVTPLLTGSNYLVWNRSMKHALGAKNKLAFVDGSIPIPPSNDLN 74 >ref|XP_006403356.1| hypothetical protein EUTSA_v10003354mg [Eutrema salsugineum] gi|557104469|gb|ESQ44809.1| hypothetical protein EUTSA_v10003354mg [Eutrema salsugineum] Length = 198 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/53 (41%), Positives = 38/53 (71%) Frame = -2 Query: 172 YYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPASS 14 +YLHP++ +I+ + L+G+NY++ + +RN LR K KLGFI+GT+ P ++ Sbjct: 34 FYLHPSDRPGDLITTVQLRGENYEDWAKHVRNALRTKRKLGFIEGTVKKPTAT 86 >gb|AAG09097.1|AC009323_8 Putative retroelement polyprotein [Arabidopsis thaliana] Length = 1486 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/79 (36%), Positives = 41/79 (51%) Frame = -2 Query: 238 TIMCYDSSKTPPPDSRYEPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKN 59 T + SS TP + Y L + +IS LL+G NYDE +LR L+A+ Sbjct: 3 TELALASSTTPARTETRRTISPYDLTSGDNPGTLISKPLLRGPNYDEWATNLRLALKARK 62 Query: 58 KLGFIDGTIPMPASSSPNY 2 K GF DG+IP P + P++ Sbjct: 63 KFGFADGSIPQPVETDPDF 81 >ref|XP_006397294.1| hypothetical protein EUTSA_v10029485mg [Eutrema salsugineum] gi|557098311|gb|ESQ38747.1| hypothetical protein EUTSA_v10029485mg [Eutrema salsugineum] Length = 196 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/51 (43%), Positives = 37/51 (72%) Frame = -2 Query: 169 YLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMPAS 17 Y+HP++ +I+ + L+G+NY++ + +RN LR K KLGFI+GT+P P + Sbjct: 2 YIHPSDRPGDLITTMQLRGENYEDWAKHVRNALRTKRKLGFIEGTLPKPTA 52 >gb|AAT40486.1| putative polyprotein [Solanum demissum] Length = 1065 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = -2 Query: 187 EPFTEYYLHPNEGISAVISPILLKGDNYDERCRSLRNNLRAKNKLGFIDGTIPMP 23 +P + Y+L + I+P++LKG NY+E +++RN RAK KLGFIDG I P Sbjct: 3 DPTSPYFLLSADHTGICITPVVLKGYNYEEWAKAMRNAFRAKKKLGFIDGLITQP 57