BLASTX nr result
ID: Achyranthes23_contig00046802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046802 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307915.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 70 4e-10 ref|XP_004168214.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 69 5e-10 ref|XP_004145959.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-spl... 69 5e-10 dbj|BAC79849.1| putative pre-mRNA splicing factor SF2 [Oryza sat... 69 8e-10 gb|EEE67802.1| hypothetical protein OsJ_25544 [Oryza sativa Japo... 69 8e-10 gb|EEC82668.1| hypothetical protein OsI_27298 [Oryza sativa Indi... 69 8e-10 ref|XP_006374084.1| hypothetical protein POPTR_0015s00690g [Popu... 68 1e-09 ref|XP_006347508.1| PREDICTED: pre-mRNA-splicing factor SF2 isof... 68 1e-09 ref|XP_006347507.1| PREDICTED: pre-mRNA-splicing factor SF2 isof... 68 1e-09 ref|XP_004984425.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 68 1e-09 ref|XP_004984424.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 68 1e-09 ref|XP_004235015.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 68 1e-09 ref|NP_001275408.1| pre-mRNA splicing factor-like protein [Solan... 68 1e-09 ref|XP_003602366.1| RNA-binding protein [Medicago truncatula] gi... 67 2e-09 ref|XP_003602365.1| RNA-binding protein [Medicago truncatula] gi... 67 2e-09 ref|XP_003602364.1| RNA-binding protein [Medicago truncatula] gi... 67 2e-09 ref|XP_006493195.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 67 2e-09 ref|XP_006441230.1| hypothetical protein CICLE_v10021646mg [Citr... 67 2e-09 ref|XP_006441229.1| hypothetical protein CICLE_v10021646mg [Citr... 67 2e-09 ref|XP_006376671.1| pre-mRNA splicing factor family protein [Pop... 67 2e-09 >ref|XP_004307915.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Fragaria vesca subsp. vesca] Length = 266 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSRTIYVGNLP+DI+EREVEDLFYKYGRILD Sbjct: 1 MSGRFSRTIYVGNLPSDIREREVEDLFYKYGRILD 35 >ref|XP_004168214.1| PREDICTED: pre-mRNA-splicing factor SF2-like, partial [Cucumis sativus] Length = 106 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MSSRFSRTIYVGNLP+DIKE E+EDLFYKYGRILD Sbjct: 1 MSSRFSRTIYVGNLPSDIKEYEIEDLFYKYGRILD 35 >ref|XP_004145959.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-splicing factor SF2-like [Cucumis sativus] Length = 248 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MSSRFSRTIYVGNLP+DIKE E+EDLFYKYGRILD Sbjct: 1 MSSRFSRTIYVGNLPSDIKEYEIEDLFYKYGRILD 35 >dbj|BAC79849.1| putative pre-mRNA splicing factor SF2 [Oryza sativa Japonica Group] Length = 362 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 171 LANFKMSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 LA +MS R+SRTIYVGNLP DI+EREVEDLFYKYGRI+D Sbjct: 62 LAEGRMSRRWSRTIYVGNLPGDIREREVEDLFYKYGRIVD 101 >gb|EEE67802.1| hypothetical protein OsJ_25544 [Oryza sativa Japonica Group] Length = 338 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 171 LANFKMSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 LA +MS R+SRTIYVGNLP DI+EREVEDLFYKYGRI+D Sbjct: 62 LAEGRMSRRWSRTIYVGNLPGDIREREVEDLFYKYGRIVD 101 >gb|EEC82668.1| hypothetical protein OsI_27298 [Oryza sativa Indica Group] Length = 321 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 171 LANFKMSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 LA +MS R+SRTIYVGNLP DI+EREVEDLFYKYGRI+D Sbjct: 62 LAEGRMSRRWSRTIYVGNLPGDIREREVEDLFYKYGRIVD 101 >ref|XP_006374084.1| hypothetical protein POPTR_0015s00690g [Populus trichocarpa] gi|550321685|gb|ERP51881.1| hypothetical protein POPTR_0015s00690g [Populus trichocarpa] Length = 260 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSRTIYVGNLPADI+E E+EDLFYKYGRILD Sbjct: 1 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRILD 35 >ref|XP_006347508.1| PREDICTED: pre-mRNA-splicing factor SF2 isoform X2 [Solanum tuberosum] Length = 271 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSR+IYVGNLPADIKE EVEDLFYKYGRILD Sbjct: 1 MSGRFSRSIYVGNLPADIKELEVEDLFYKYGRILD 35 >ref|XP_006347507.1| PREDICTED: pre-mRNA-splicing factor SF2 isoform X1 [Solanum tuberosum] Length = 273 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSR+IYVGNLPADIKE EVEDLFYKYGRILD Sbjct: 1 MSGRFSRSIYVGNLPADIKELEVEDLFYKYGRILD 35 >ref|XP_004984425.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X2 [Setaria italica] Length = 295 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 183 KMSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 KMS R+SRTIYVGNLP DI+EREVEDLFYKYGRI+D Sbjct: 12 KMSRRWSRTIYVGNLPGDIREREVEDLFYKYGRIVD 47 >ref|XP_004984424.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Setaria italica] Length = 297 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 183 KMSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 KMS R+SRTIYVGNLP DI+EREVEDLFYKYGRI+D Sbjct: 12 KMSRRWSRTIYVGNLPGDIREREVEDLFYKYGRIVD 47 >ref|XP_004235015.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Solanum lycopersicum] Length = 288 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSR+IYVGNLPADIKE EVEDLFYKYGRILD Sbjct: 1 MSGRFSRSIYVGNLPADIKELEVEDLFYKYGRILD 35 >ref|NP_001275408.1| pre-mRNA splicing factor-like protein [Solanum tuberosum] gi|76573323|gb|ABA46766.1| pre-mRNA splicing factor-like protein [Solanum tuberosum] Length = 269 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSR+IYVGNLPADIKE EVEDLFYKYGRILD Sbjct: 1 MSGRFSRSIYVGNLPADIKELEVEDLFYKYGRILD 35 >ref|XP_003602366.1| RNA-binding protein [Medicago truncatula] gi|355491414|gb|AES72617.1| RNA-binding protein [Medicago truncatula] Length = 273 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MSSRFSRTIYVGNLPADI+E E+EDLFYKYGRI++ Sbjct: 1 MSSRFSRTIYVGNLPADIRESEIEDLFYKYGRIME 35 >ref|XP_003602365.1| RNA-binding protein [Medicago truncatula] gi|355491413|gb|AES72616.1| RNA-binding protein [Medicago truncatula] Length = 272 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MSSRFSRTIYVGNLPADI+E E+EDLFYKYGRI++ Sbjct: 1 MSSRFSRTIYVGNLPADIRESEIEDLFYKYGRIME 35 >ref|XP_003602364.1| RNA-binding protein [Medicago truncatula] gi|355491412|gb|AES72615.1| RNA-binding protein [Medicago truncatula] Length = 380 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MSSRFSRTIYVGNLPADI+E E+EDLFYKYGRI++ Sbjct: 108 MSSRFSRTIYVGNLPADIRESEIEDLFYKYGRIME 142 >ref|XP_006493195.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Citrus sinensis] gi|568880594|ref|XP_006493196.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X2 [Citrus sinensis] gi|568880596|ref|XP_006493197.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X3 [Citrus sinensis] Length = 277 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSRTIYVGNLP+DI+E EVEDLFYKYGRILD Sbjct: 1 MSGRFSRTIYVGNLPSDIREYEVEDLFYKYGRILD 35 >ref|XP_006441230.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] gi|557543492|gb|ESR54470.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] Length = 271 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSRTIYVGNLP+DI+E EVEDLFYKYGRILD Sbjct: 1 MSGRFSRTIYVGNLPSDIREYEVEDLFYKYGRILD 35 >ref|XP_006441229.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] gi|567897486|ref|XP_006441231.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] gi|567897488|ref|XP_006441232.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] gi|567897490|ref|XP_006441233.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] gi|557543491|gb|ESR54469.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] gi|557543493|gb|ESR54471.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] gi|557543494|gb|ESR54472.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] gi|557543495|gb|ESR54473.1| hypothetical protein CICLE_v10021646mg [Citrus clementina] Length = 271 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSRTIYVGNLP+DI+E EVEDLFYKYGRILD Sbjct: 1 MSGRFSRTIYVGNLPSDIREYEVEDLFYKYGRILD 35 >ref|XP_006376671.1| pre-mRNA splicing factor family protein [Populus trichocarpa] gi|550326255|gb|ERP54468.1| pre-mRNA splicing factor family protein [Populus trichocarpa] Length = 279 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 186 MSSRFSRTIYVGNLPADIKEREVEDLFYKYGRILD 290 MS RFSRTIYVGNLPADI+E +VEDLFYKYGRILD Sbjct: 1 MSGRFSRTIYVGNLPADIRESKVEDLFYKYGRILD 35