BLASTX nr result
ID: Achyranthes23_contig00046792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046792 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY02923.1| Kinase interacting family protein, putative [Theo... 59 7e-07 >gb|EOY02923.1| Kinase interacting family protein, putative [Theobroma cacao] Length = 290 Score = 58.9 bits (141), Expect = 7e-07 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 2/82 (2%) Frame = +1 Query: 139 LRCTFTKLVEENTELQVELIRRNSEKRETIIKLQNQVRKLRIENDNLQRTL--SYFNRNK 312 L+ FTKL+EEN Q EL RRN EKRETI +LQ Q+ L+ EN LQ+ L S + Sbjct: 209 LKFQFTKLMEENLRQQAELFRRNEEKRETINELQLQLEHLKSENRALQKCLHSSKIGVKR 268 Query: 313 HHIQDDSLKKALLIDKFLGVCS 378 +H Q + L F G CS Sbjct: 269 NHSQTSRSRGLFLGKFFQGGCS 290