BLASTX nr result
ID: Achyranthes23_contig00046783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046783 (252 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = +3 Query: 24 KMHKFFGLCKIAYDQ*VDLATLYMINSTEKWVSSYLYVRSKVTLDDFVADLYARFGDEN 200 K K+F CKI Q VDLA+L M++ E WVSSYL R+ V +DFV D+ +RF DE+ Sbjct: 51 KCCKYFVFCKIPDKQKVDLASLNMVDKAENWVSSYLINRTAVDWNDFVIDVNSRFKDES 109