BLASTX nr result
ID: Achyranthes23_contig00046781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046781 (386 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307758.1| hypothetical protein POPTR_0005s26800g [Popu... 57 3e-06 gb|ABK95398.1| unknown [Populus trichocarpa] 57 3e-06 ref|XP_004500901.1| PREDICTED: high mobility group B protein 9-l... 55 7e-06 >ref|XP_002307758.1| hypothetical protein POPTR_0005s26800g [Populus trichocarpa] gi|222857207|gb|EEE94754.1| hypothetical protein POPTR_0005s26800g [Populus trichocarpa] Length = 329 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = +3 Query: 273 EKYNYPSPVATHEEVVNEPKLFIDTLKSFHSLMGTKFM 386 E +YP+P+A+HE+VVN+P +F DTL+ FH +MGTKFM Sbjct: 14 ENKHYPAPLASHEDVVNDPSVFWDTLRRFHFVMGTKFM 51 >gb|ABK95398.1| unknown [Populus trichocarpa] Length = 317 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = +3 Query: 273 EKYNYPSPVATHEEVVNEPKLFIDTLKSFHSLMGTKFM 386 E +YP+P+A+HE+VVN+P +F DTL+ FH +MGTKFM Sbjct: 2 ENKHYPAPLASHEDVVNDPSVFWDTLRRFHFVMGTKFM 39 >ref|XP_004500901.1| PREDICTED: high mobility group B protein 9-like [Cicer arietinum] Length = 324 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +3 Query: 261 TSENEKYNYPSPVATHEEVVNEPKLFIDTLKSFHSLMGTKFM 386 +S++E YP P+A+H +VVN+P LF DTL+ FH LM TKFM Sbjct: 9 SSDDEGKQYPPPLASHNDVVNDPTLFWDTLRRFHFLMATKFM 50