BLASTX nr result
ID: Achyranthes23_contig00046708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046708 (243 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350926.1| PREDICTED: protein LURP-one-related 7-like [... 71 1e-10 ref|XP_004242493.1| PREDICTED: protein LURP-one-related 7-like [... 67 2e-09 emb|CBI15857.3| unnamed protein product [Vitis vinifera] 63 4e-08 ref|XP_002277024.1| PREDICTED: protein LURP-one-related 7-like [... 63 4e-08 ref|XP_006410136.1| hypothetical protein EUTSA_v10017277mg [Eutr... 61 1e-07 ref|XP_006295069.1| hypothetical protein CARUB_v10024138mg [Caps... 57 3e-06 ref|NP_180586.2| uncharacterized protein [Arabidopsis thaliana] ... 57 3e-06 gb|EPS67691.1| hypothetical protein M569_07086, partial [Genlise... 56 4e-06 ref|XP_003544911.1| PREDICTED: protein LURP-one-related 7-like i... 56 6e-06 ref|XP_002881096.1| hypothetical protein ARALYDRAFT_902011 [Arab... 55 7e-06 >ref|XP_006350926.1| PREDICTED: protein LURP-one-related 7-like [Solanum tuberosum] Length = 201 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/49 (59%), Positives = 42/49 (85%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDGRK 87 I+A T+LMY LGFRKHF+ R++FRVT+FPGF++ S++ +L++VF D RK Sbjct: 150 IVAETSLMYTLGFRKHFIPRNRFRVTIFPGFAELSLVVALVVVFFDKRK 198 >ref|XP_004242493.1| PREDICTED: protein LURP-one-related 7-like [Solanum lycopersicum] Length = 200 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/49 (55%), Positives = 41/49 (83%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDGRK 87 I+A T+LMY LGFRKHF+ R++FRVT+FPG ++ S++ +L++VF D +K Sbjct: 149 IVAETSLMYTLGFRKHFIPRNRFRVTIFPGLTELSLVVALVVVFFDKQK 197 >emb|CBI15857.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/49 (57%), Positives = 40/49 (81%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDGRK 87 I+A T+LMYKLG K FVGR KFR+T+FPG D++++ +LI++F DGR+ Sbjct: 370 IVAQTSLMYKLG--KAFVGRCKFRLTIFPGSGDHAVVMALIVIFFDGRR 416 >ref|XP_002277024.1| PREDICTED: protein LURP-one-related 7-like [Vitis vinifera] Length = 186 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/49 (57%), Positives = 40/49 (81%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDGRK 87 I+A T+LMYKLG K FVGR KFR+T+FPG D++++ +LI++F DGR+ Sbjct: 137 IVAQTSLMYKLG--KAFVGRCKFRLTIFPGSGDHAVVMALIVIFFDGRR 183 >ref|XP_006410136.1| hypothetical protein EUTSA_v10017277mg [Eutrema salsugineum] gi|557111305|gb|ESQ51589.1| hypothetical protein EUTSA_v10017277mg [Eutrema salsugineum] Length = 190 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/49 (57%), Positives = 40/49 (81%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDGRK 87 I+A T+LMYKL R+ +VGRSKFR+T+FPG D+S++ +++ VFL GRK Sbjct: 144 IVAQTSLMYKL--RQIYVGRSKFRLTIFPGSMDHSLVVAMVAVFLQGRK 190 >ref|XP_006295069.1| hypothetical protein CARUB_v10024138mg [Capsella rubella] gi|482563777|gb|EOA27967.1| hypothetical protein CARUB_v10024138mg [Capsella rubella] Length = 184 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDG 93 I+A T+LMYKL R+ +VGRSKFR+T+FPG D+S++ +++ VFL G Sbjct: 140 IVAQTSLMYKL--RQIYVGRSKFRLTIFPGSIDHSLVVAMVAVFLQG 184 >ref|NP_180586.2| uncharacterized protein [Arabidopsis thaliana] gi|75150998|sp|Q8GWL2.1|LOR7_ARATH RecName: Full=Protein LURP-one-related 7 gi|26452565|dbj|BAC43367.1| unknown protein [Arabidopsis thaliana] gi|28973165|gb|AAO63907.1| unknown protein [Arabidopsis thaliana] gi|330253270|gb|AEC08364.1| uncharacterized protein AT2G30270 [Arabidopsis thaliana] Length = 182 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/47 (53%), Positives = 38/47 (80%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDG 93 I+A T+LMYKL R+ +VGRSKFR+T+FPG D+S++ +++ +FL G Sbjct: 138 IVAQTSLMYKL--RQIYVGRSKFRLTIFPGSIDHSLVVAMVAIFLQG 182 >gb|EPS67691.1| hypothetical protein M569_07086, partial [Genlisea aurea] Length = 192 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 3/52 (5%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFS---DYSIIASLILVFLDGRK 87 I+A T+LMY++G K FV RS+FRVT+FPGF S++A+ ++++ DGRK Sbjct: 138 IVAETSLMYRIGVGKLFVPRSRFRVTLFPGFHQSLSSSLVAAFVVLYFDGRK 189 >ref|XP_003544911.1| PREDICTED: protein LURP-one-related 7-like isoform X1 [Glycine max] gi|571511652|ref|XP_006596454.1| PREDICTED: protein LURP-one-related 7-like isoform X2 [Glycine max] gi|571511658|ref|XP_006596455.1| PREDICTED: protein LURP-one-related 7-like isoform X3 [Glycine max] Length = 197 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = -2 Query: 242 DKFIIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDGRK 87 D ++A ++LMYKL + FV RSKFR+T+FPG D+++I +L ++FL GRK Sbjct: 148 DADLVAQSSLMYKL--HQMFVSRSKFRLTIFPGTIDHALIVALFVIFLSGRK 197 >ref|XP_002881096.1| hypothetical protein ARALYDRAFT_902011 [Arabidopsis lyrata subsp. lyrata] gi|297326935|gb|EFH57355.1| hypothetical protein ARALYDRAFT_902011 [Arabidopsis lyrata subsp. lyrata] Length = 182 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/47 (53%), Positives = 37/47 (78%) Frame = -2 Query: 233 IIAHTNLMYKLGFRKHFVGRSKFRVTVFPGFSDYSIIASLILVFLDG 93 I+A T+LMYKL R+ +VGRSKFR+T+FPG D+S++ +++ FL G Sbjct: 138 IVAQTSLMYKL--RQIYVGRSKFRLTIFPGSIDHSLVVAMVATFLQG 182