BLASTX nr result
ID: Achyranthes23_contig00046591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046591 (203 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum ... 57 3e-06 >gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1333 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/67 (52%), Positives = 44/67 (65%) Frame = -3 Query: 201 KAYRLYNPISVKVIISRNVIFNEDTN*DWRVQQDTSTISPVPADFQSEELCRENSNQSSL 22 KAYRLYNPIS KVIISRNV+FNED + ++ S I +P D +S + NS SS Sbjct: 704 KAYRLYNPISGKVIISRNVVFNEDVSWNFNSGNMMSNIQLLPTDEES-AVDFGNSPNSSP 762 Query: 21 VSSTANS 1 VSS+ +S Sbjct: 763 VSSSVSS 769