BLASTX nr result
ID: Achyranthes23_contig00046438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046438 (441 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT10574.1| hypothetical protein F775_16580 [Aegilops tauschii] 71 2e-10 ref|XP_003581340.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_006653508.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_002306801.2| pentatricopeptide repeat-containing family p... 70 4e-10 gb|EEE61157.1| hypothetical protein OsJ_15124 [Oryza sativa Japo... 69 5e-10 ref|NP_001053044.1| Os04g0469400 [Oryza sativa Japonica Group] g... 69 5e-10 emb|CAE06013.3| OSJNBa0016O02.23 [Oryza sativa Japonica Group] g... 69 5e-10 gb|EPS63069.1| hypothetical protein M569_11717 [Genlisea aurea] 68 1e-09 ref|XP_004975912.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_004971550.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002891372.1| hypothetical protein ARALYDRAFT_473903 [Arab... 68 1e-09 gb|ESW19934.1| hypothetical protein PHAVU_006G167300g [Phaseolus... 67 2e-09 ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 gb|EXB51999.1| hypothetical protein L484_019777 [Morus notabilis] 67 3e-09 ref|XP_006658280.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_006338733.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_006338732.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 gb|EOX94627.1| Tetratricopeptide repeat-like superfamily protein... 66 4e-09 ref|XP_004494044.1| PREDICTED: putative pentatricopeptide repeat... 66 4e-09 >gb|EMT10574.1| hypothetical protein F775_16580 [Aegilops tauschii] Length = 942 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVSK+F+REI+VRDA+RFHHF+ GSCSCGDFW Sbjct: 906 HEFTKLVSKLFEREIVVRDANRFHHFRGGSCSCGDFW 942 >ref|XP_003581340.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like [Brachypodium distachyon] Length = 940 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVSK+FDR+I+VRDA+RFHHF GSCSCGDFW Sbjct: 904 HEFTKLVSKLFDRDIVVRDANRFHHFSGGSCSCGDFW 940 >ref|XP_006653508.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like [Oryza brachyantha] Length = 939 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVSK+F+REI+VRDA+RFHHF GSCSCGDFW Sbjct: 903 HEFTKLVSKLFEREIVVRDANRFHHFSGGSCSCGDFW 939 >ref|XP_002306801.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550339617|gb|EEE93797.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 818 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVSK F+RE+IVRDASRFHHF+ G CSCGDFW Sbjct: 782 HTFCKLVSKFFERELIVRDASRFHHFEDGVCSCGDFW 818 >gb|EEE61157.1| hypothetical protein OsJ_15124 [Oryza sativa Japonica Group] Length = 383 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVSK+F+REI+VRDA+RFHHF G+CSCGDFW Sbjct: 347 HEFTKLVSKLFEREIVVRDANRFHHFSGGTCSCGDFW 383 >ref|NP_001053044.1| Os04g0469400 [Oryza sativa Japonica Group] gi|113564615|dbj|BAF14958.1| Os04g0469400, partial [Oryza sativa Japonica Group] Length = 401 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVSK+F+REI+VRDA+RFHHF G+CSCGDFW Sbjct: 365 HEFTKLVSKLFEREIVVRDANRFHHFSGGTCSCGDFW 401 >emb|CAE06013.3| OSJNBa0016O02.23 [Oryza sativa Japonica Group] gi|116310014|emb|CAH67039.1| OSIGBa0124N08.1 [Oryza sativa Indica Group] gi|116310420|emb|CAH67428.1| OSIGBa0150F01.8 [Oryza sativa Indica Group] Length = 939 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVSK+F+REI+VRDA+RFHHF G+CSCGDFW Sbjct: 903 HEFTKLVSKLFEREIVVRDANRFHHFSGGTCSCGDFW 939 >gb|EPS63069.1| hypothetical protein M569_11717 [Genlisea aurea] Length = 601 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 HV IKLVSKIF+RE++VRD SRFHHF GSCSC DFW Sbjct: 565 HVAIKLVSKIFEREVVVRDLSRFHHFARGSCSCKDFW 601 >ref|XP_004975912.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like [Setaria italica] Length = 953 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVSK+F+R+I+VRDA+RFHHF G+CSCGDFW Sbjct: 917 HEFTKLVSKLFERDIVVRDANRFHHFSGGACSCGDFW 953 >ref|XP_004971550.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like [Setaria italica] Length = 767 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F +LVSK+F+R+I+VRDA+RFHHF GSCSCGDFW Sbjct: 731 HEFTELVSKLFERDIVVRDANRFHHFSGGSCSCGDFW 767 >ref|XP_002891372.1| hypothetical protein ARALYDRAFT_473903 [Arabidopsis lyrata subsp. lyrata] gi|297337214|gb|EFH67631.1| hypothetical protein ARALYDRAFT_473903 [Arabidopsis lyrata subsp. lyrata] Length = 415 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H FIK++S I DREIIVRD RFHHF+YGSCSCGD+W Sbjct: 379 HNFIKILSSIEDREIIVRDNKRFHHFRYGSCSCGDYW 415 >gb|ESW19934.1| hypothetical protein PHAVU_006G167300g [Phaseolus vulgaris] Length = 611 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 HV IKL+SKI+DREI++RD SRFHHF+ GSCSC D+W Sbjct: 575 HVAIKLISKIYDREIVIRDRSRFHHFRGGSCSCKDYW 611 >ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum tuberosum] Length = 585 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H+ IKL+SK+FDREI+VRD SRFHHF GSCSC D+W Sbjct: 549 HLAIKLISKVFDREIVVRDRSRFHHFTNGSCSCKDYW 585 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Setaria italica] Length = 594 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H+ IKL+SKI+DREIIVRD SRFHHF+ GSCSC D+W Sbjct: 558 HMAIKLISKIYDREIIVRDRSRFHHFKGGSCSCKDYW 594 >gb|EXB51999.1| hypothetical protein L484_019777 [Morus notabilis] Length = 623 Score = 66.6 bits (161), Expect = 3e-09 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 HV +KL+SK++DREI VRD +RFHHF+ G+CSCGD+W Sbjct: 587 HVALKLISKVYDREIAVRDCTRFHHFKNGTCSCGDYW 623 >ref|XP_006658280.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Oryza brachyantha] Length = 537 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 HV IKL+SK++DREIIVRD SRFHHF+ G+CSC D+W Sbjct: 501 HVAIKLISKVYDREIIVRDRSRFHHFKGGTCSCKDYW 537 >ref|XP_006338733.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 619 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H IKL+SKI +REI+VRDA RFHHF+ GSCSCGD+W Sbjct: 583 HTTIKLISKIVNREIVVRDAKRFHHFKDGSCSCGDYW 619 >ref|XP_006338732.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 645 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H IKL+SKI +REI+VRDA RFHHF+ GSCSCGD+W Sbjct: 609 HTTIKLISKIVNREIVVRDAKRFHHFKDGSCSCGDYW 645 >gb|EOX94627.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 966 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 H F KLVS++F RE++VRDA+RFHHF+ G CSCGDFW Sbjct: 930 HTFCKLVSELFGRELVVRDANRFHHFEGGVCSCGDFW 966 >ref|XP_004494044.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Cicer arietinum] Length = 641 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 439 HVFIKLVSKIFDREIIVRDASRFHHFQYGSCSCGDFW 329 HVFIKLVSKI DR+ IVRDA+RFHHF+ G CSC D+W Sbjct: 605 HVFIKLVSKIVDRQFIVRDATRFHHFRNGVCSCKDYW 641