BLASTX nr result
ID: Achyranthes23_contig00046372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046372 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006591461.1| PREDICTED: OTU domain-containing protein At3... 64 3e-08 ref|XP_006591460.1| PREDICTED: OTU domain-containing protein At3... 64 3e-08 ref|XP_004135307.1| PREDICTED: OTU domain-containing protein At3... 63 5e-08 gb|ESW35734.1| hypothetical protein PHAVU_001G260200g [Phaseolus... 62 6e-08 gb|ESW35733.1| hypothetical protein PHAVU_001G260200g [Phaseolus... 62 6e-08 ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Popu... 62 1e-07 ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Popu... 62 1e-07 ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Popu... 62 1e-07 ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 61 1e-07 gb|EXB94991.1| hypothetical protein L484_006757 [Morus notabilis] 61 2e-07 ref|XP_004502312.1| PREDICTED: OTU domain-containing protein At3... 60 3e-07 gb|EMS60950.1| U-box domain-containing protein 6 [Triticum urartu] 60 4e-07 ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3... 60 4e-07 ref|XP_004970933.1| PREDICTED: OTU domain-containing protein At3... 59 5e-07 ref|XP_004970932.1| PREDICTED: OTU domain-containing protein At3... 59 5e-07 ref|XP_003601809.1| OTU domain-containing protein 6B [Medicago t... 59 7e-07 ref|XP_003564852.1| PREDICTED: OTU domain-containing protein At3... 59 9e-07 dbj|BAJ97974.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 gb|EEC71971.1| hypothetical protein OsI_04808 [Oryza sativa Indi... 57 2e-06 ref|NP_001045107.1| Os01g0900900 [Oryza sativa Japonica Group] g... 57 2e-06 >ref|XP_006591461.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X2 [Glycine max] Length = 146 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDAL 110 D SSN K+IAEYGQEYG+ N + V+YHGYGHYDAL Sbjct: 105 DKSSSNLKVIAEYGQEYGKDNPIRVIYHGYGHYDAL 140 >ref|XP_006591460.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X1 [Glycine max] Length = 153 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDAL 110 D SSN K+IAEYGQEYG+ N + V+YHGYGHYDAL Sbjct: 112 DKSSSNLKVIAEYGQEYGKDNPIRVIYHGYGHYDAL 147 >ref|XP_004135307.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449494889|ref|XP_004159675.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 145 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALKS 116 D KS N K+IAEYGQEYG++N + VL+H YGHYD+LK+ Sbjct: 105 DKKSGNLKVIAEYGQEYGKENPIRVLFHSYGHYDSLKA 142 >gb|ESW35734.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] Length = 150 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDAL 110 D SSN K+IAEYG+EYG+ N + V+YHGYGHYDAL Sbjct: 105 DKNSSNLKVIAEYGEEYGKDNPIRVIYHGYGHYDAL 140 >gb|ESW35733.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] Length = 157 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDAL 110 D SSN K+IAEYG+EYG+ N + V+YHGYGHYDAL Sbjct: 112 DKNSSNLKVIAEYGEEYGKDNPIRVIYHGYGHYDAL 147 >ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333321|gb|ERP57731.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 155 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDAL 110 D S + KIIAEYGQEYG +N V VLYHGYGHYDAL Sbjct: 105 DRSSGSLKIIAEYGQEYGNENPVRVLYHGYGHYDAL 140 >ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333320|gb|ERP57730.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDAL 110 D S + KIIAEYGQEYG +N V VLYHGYGHYDAL Sbjct: 113 DRSSGSLKIIAEYGQEYGNENPVRVLYHGYGHYDAL 148 >ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333319|gb|EEE89088.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDAL 110 D S + KIIAEYGQEYG +N V VLYHGYGHYDAL Sbjct: 113 DRSSGSLKIIAEYGQEYGNENPVRVLYHGYGHYDAL 148 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALKS 116 D S + K+IAEYGQEYG++N + VLYHGYGHYDAL++ Sbjct: 121 DRNSGSLKVIAEYGQEYGKENPICVLYHGYGHYDALQN 158 >gb|EXB94991.1| hypothetical protein L484_006757 [Morus notabilis] Length = 158 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALKS 116 D S + KIIAEYGQEYG+ N + VLY+GYGHYDAL+S Sbjct: 112 DKNSGSLKIIAEYGQEYGKDNPIRVLYNGYGHYDALRS 149 >ref|XP_004502312.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cicer arietinum] Length = 149 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALKS 116 D S+N KIIAEYGQEYG++N V V+Y GYGHYD ++S Sbjct: 112 DTNSNNLKIIAEYGQEYGKENPVRVIYDGYGHYDVIQS 149 >gb|EMS60950.1| U-box domain-containing protein 6 [Triticum urartu] Length = 967 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 12 SSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 + NP+IIAEYGQEYG+ N V VLY GYGHYDAL+ Sbjct: 809 TDNPRIIAEYGQEYGKDNPVRVLYDGYGHYDALQ 842 >ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3g57810-like [Fragaria vesca subsp. vesca] Length = 164 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 D S + +IIAEYGQEYG N + VLYHGYGHYDAL+ Sbjct: 105 DKNSRSLRIIAEYGQEYGNDNPIRVLYHGYGHYDALR 141 >ref|XP_004970933.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X2 [Setaria italica] Length = 158 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 6 NKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 + S +P+IIAEYGQEYG+ N V VLY GYGHYDAL+ Sbjct: 110 SSSDSPRIIAEYGQEYGKDNPVRVLYDGYGHYDALQ 145 >ref|XP_004970932.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X1 [Setaria italica] Length = 168 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 6 NKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 + S +P+IIAEYGQEYG+ N V VLY GYGHYDAL+ Sbjct: 110 SSSDSPRIIAEYGQEYGKDNPVRVLYDGYGHYDALQ 145 >ref|XP_003601809.1| OTU domain-containing protein 6B [Medicago truncatula] gi|355490857|gb|AES72060.1| OTU domain-containing protein 6B [Medicago truncatula] Length = 177 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +3 Query: 3 DNKSSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 D S+N KIIAEYGQEYG++N + V+Y G+GHYD LK Sbjct: 138 DTNSNNLKIIAEYGQEYGKENPIRVIYDGFGHYDVLK 174 >ref|XP_003564852.1| PREDICTED: OTU domain-containing protein At3g57810-like [Brachypodium distachyon] Length = 157 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 12 SSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 S P+IIAEYGQEYG+ N V VLY GYGHYDAL+ Sbjct: 112 SDGPRIIAEYGQEYGKDNPVRVLYDGYGHYDALQ 145 >dbj|BAJ97974.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 158 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 12 SSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 + +P+IIAEYGQEYG+ N V VLY GYGHYDAL+ Sbjct: 112 ADSPRIIAEYGQEYGKDNPVRVLYDGYGHYDALQ 145 >gb|EEC71971.1| hypothetical protein OsI_04808 [Oryza sativa Indica Group] gi|222619694|gb|EEE55826.1| hypothetical protein OsJ_04432 [Oryza sativa Japonica Group] Length = 173 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 12 SSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 S +P+IIAEYGQEYG+ N + VLY GYGHYDAL+ Sbjct: 112 SDSPRIIAEYGQEYGKDNPICVLYDGYGHYDALQ 145 >ref|NP_001045107.1| Os01g0900900 [Oryza sativa Japonica Group] gi|113534638|dbj|BAF07021.1| Os01g0900900 [Oryza sativa Japonica Group] Length = 166 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 12 SSNPKIIAEYGQEYGRQNTVHVLYHGYGHYDALK 113 S +P+IIAEYGQEYG+ N + VLY GYGHYDAL+ Sbjct: 112 SDSPRIIAEYGQEYGKDNPICVLYDGYGHYDALQ 145