BLASTX nr result
ID: Achyranthes23_contig00046167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046167 (476 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430643.1| hypothetical protein CICLE_v10013091mg [Citr... 57 3e-06 >ref|XP_006430643.1| hypothetical protein CICLE_v10013091mg [Citrus clementina] gi|557532700|gb|ESR43883.1| hypothetical protein CICLE_v10013091mg [Citrus clementina] Length = 133 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 474 KKTIIKGGKCKPLDFSGKIEYDSEGNLLPD 385 ++TI++G +C+PLDFSGKIEYDSEGNLLPD Sbjct: 103 RRTIMRGERCRPLDFSGKIEYDSEGNLLPD 132