BLASTX nr result
ID: Achyranthes23_contig00046013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00046013 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006412638.1| hypothetical protein EUTSA_v10025875mg [Eutr... 55 1e-05 >ref|XP_006412638.1| hypothetical protein EUTSA_v10025875mg [Eutrema salsugineum] gi|557113808|gb|ESQ54091.1| hypothetical protein EUTSA_v10025875mg [Eutrema salsugineum] Length = 294 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/49 (57%), Positives = 30/49 (61%) Frame = -1 Query: 152 MGNVTSNVXXXXXXXXXXXPTYNVTKVEEDGKWVFTGISPDNNVDVHVL 6 MGNVTSNV TY VTK EE GK VF G+SPD NV+VH L Sbjct: 1 MGNVTSNVAAKFAFFPPEPATYGVTKDEETGKLVFAGVSPDKNVEVHQL 49