BLASTX nr result
ID: Achyranthes23_contig00045866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00045866 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351292.1| PREDICTED: probable calcium-binding protein ... 57 2e-06 ref|XP_004249218.1| PREDICTED: probable calcium-binding protein ... 57 2e-06 ref|XP_006398873.1| hypothetical protein EUTSA_v10013932mg [Eutr... 57 3e-06 ref|XP_004303640.1| PREDICTED: probable calcium-binding protein ... 57 3e-06 ref|XP_002534120.1| ef-hand calcium binding protein, putative [R... 57 3e-06 ref|XP_006489868.1| PREDICTED: probable calcium-binding protein ... 56 4e-06 ref|XP_006421162.1| hypothetical protein CICLE_v10005529mg [Citr... 56 4e-06 gb|AFC76102.1| calcium-dependent protein kinase, partial [Haloxy... 56 4e-06 gb|AEX86943.1| EFh calcium-binding protein [Haloxylon ammodendron] 56 4e-06 ref|XP_003578961.1| PREDICTED: probable calcium-binding protein ... 56 4e-06 gb|ACN39566.1| EF-hand motif containing protein [Juglans nigra] 56 4e-06 ref|XP_004978627.1| PREDICTED: probable calcium-binding protein ... 55 7e-06 gb|EMJ05905.1| hypothetical protein PRUPE_ppa009740mg [Prunus pe... 55 7e-06 gb|AFW64764.1| grancalcin [Zea mays] 55 7e-06 gb|AFW64763.1| hypothetical protein ZEAMMB73_778929 [Zea mays] 55 7e-06 ref|XP_002450240.1| hypothetical protein SORBIDRAFT_05g002410 [S... 55 7e-06 gb|ACN31166.1| unknown [Zea mays] 55 7e-06 ref|NP_001147282.1| grancalcin [Zea mays] gi|195609464|gb|ACG265... 55 7e-06 ref|XP_004139489.1| PREDICTED: probable calcium-binding protein ... 55 1e-05 emb|CBI33386.3| unnamed protein product [Vitis vinifera] 55 1e-05 >ref|XP_006351292.1| PREDICTED: probable calcium-binding protein CML49-like [Solanum tuberosum] Length = 344 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD +YSGSATFTYE FML VLP++IA Sbjct: 313 TEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 344 >ref|XP_004249218.1| PREDICTED: probable calcium-binding protein CML49-like [Solanum lycopersicum] Length = 340 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD +YSGSATFTYE FML VLP++IA Sbjct: 309 TEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 340 >ref|XP_006398873.1| hypothetical protein EUTSA_v10013932mg [Eutrema salsugineum] gi|557099963|gb|ESQ40326.1| hypothetical protein EUTSA_v10013932mg [Eutrema salsugineum] Length = 358 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD YSGSATFTYE FML VLP++IA Sbjct: 327 TEKFKEKDTGYSGSATFTYETFMLTVLPFLIA 358 >ref|XP_004303640.1| PREDICTED: probable calcium-binding protein CML49-like [Fragaria vesca subsp. vesca] Length = 289 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKDK Y+G ATF+YE+FMLIVLP++IA Sbjct: 258 TEKFKEKDKAYTGHATFSYEEFMLIVLPFLIA 289 >ref|XP_002534120.1| ef-hand calcium binding protein, putative [Ricinus communis] gi|223525823|gb|EEF28264.1| ef-hand calcium binding protein, putative [Ricinus communis] Length = 266 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD +YSGSATFTYE FML VLP++IA Sbjct: 235 TEKFKEKDTSYSGSATFTYEAFMLTVLPFLIA 266 >ref|XP_006489868.1| PREDICTED: probable calcium-binding protein CML49-like [Citrus sinensis] Length = 283 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKE+D YSGSATFTYE+FML VLP++IA Sbjct: 252 TEKFKERDTTYSGSATFTYENFMLAVLPFLIA 283 >ref|XP_006421162.1| hypothetical protein CICLE_v10005529mg [Citrus clementina] gi|557523035|gb|ESR34402.1| hypothetical protein CICLE_v10005529mg [Citrus clementina] Length = 283 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKE+D YSGSATFTYE+FML VLP++IA Sbjct: 252 TEKFKERDTTYSGSATFTYENFMLAVLPFLIA 283 >gb|AFC76102.1| calcium-dependent protein kinase, partial [Haloxylon ammodendron] Length = 219 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYII 152 TEKFKEKDK Y+GSAT TYEDFM +VLPY++ Sbjct: 186 TEKFKEKDKRYTGSATITYEDFMSMVLPYLV 216 >gb|AEX86943.1| EFh calcium-binding protein [Haloxylon ammodendron] Length = 243 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYII 152 TEKFKEKDK Y+GSAT TYEDFM +VLPY++ Sbjct: 210 TEKFKEKDKRYTGSATITYEDFMSMVLPYLV 240 >ref|XP_003578961.1| PREDICTED: probable calcium-binding protein CML49-like isoform 1 [Brachypodium distachyon] gi|357161050|ref|XP_003578962.1| PREDICTED: probable calcium-binding protein CML49-like isoform 2 [Brachypodium distachyon] Length = 327 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD YSGSATFTYE FML VLP+IIA Sbjct: 296 TEKFKEKDTAYSGSATFTYEAFMLTVLPFIIA 327 >gb|ACN39566.1| EF-hand motif containing protein [Juglans nigra] Length = 200 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKDK YSGSA+FTYE FML VLP++IA Sbjct: 169 TEKFKEKDKAYSGSASFTYEAFMLTVLPFLIA 200 >ref|XP_004978627.1| PREDICTED: probable calcium-binding protein CML50-like [Setaria italica] Length = 307 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD YSGSATFTYE FML VLP++IA Sbjct: 276 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 307 >gb|EMJ05905.1| hypothetical protein PRUPE_ppa009740mg [Prunus persica] Length = 279 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKDK Y+G+ TF+YEDFML VLP++IA Sbjct: 248 TEKFKEKDKAYTGTGTFSYEDFMLTVLPFLIA 279 >gb|AFW64764.1| grancalcin [Zea mays] Length = 296 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD YSGSATFTYE FML VLP++IA Sbjct: 265 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 296 >gb|AFW64763.1| hypothetical protein ZEAMMB73_778929 [Zea mays] Length = 84 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD YSGSATFTYE FML VLP++IA Sbjct: 53 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 84 >ref|XP_002450240.1| hypothetical protein SORBIDRAFT_05g002410 [Sorghum bicolor] gi|241936083|gb|EES09228.1| hypothetical protein SORBIDRAFT_05g002410 [Sorghum bicolor] Length = 304 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD YSGSATFTYE FML VLP++IA Sbjct: 273 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 304 >gb|ACN31166.1| unknown [Zea mays] Length = 153 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD YSGSATFTYE FML VLP++IA Sbjct: 122 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 153 >ref|NP_001147282.1| grancalcin [Zea mays] gi|195609464|gb|ACG26562.1| grancalcin [Zea mays] Length = 301 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD YSGSATFTYE FML VLP++IA Sbjct: 270 TEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 301 >ref|XP_004139489.1| PREDICTED: probable calcium-binding protein CML48-like [Cucumis sativus] gi|449527635|ref|XP_004170815.1| PREDICTED: probable calcium-binding protein CML48-like [Cucumis sativus] Length = 251 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD+NY+GSAT TYEDFM +LP++++ Sbjct: 218 TEKFKEKDRNYTGSATLTYEDFMSTILPFLVS 249 >emb|CBI33386.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 244 TEKFKEKDKNYSGSATFTYEDFMLIVLPYIIA 149 TEKFKEKD ++SGSATF+YE+FML VLP++IA Sbjct: 283 TEKFKEKDSSFSGSATFSYENFMLTVLPFLIA 314