BLASTX nr result
ID: Achyranthes23_contig00045778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00045778 (380 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532772.1| pentatricopeptide repeat-containing protein,... 112 7e-23 emb|CBI28908.3| unnamed protein product [Vitis vinifera] 111 9e-23 gb|EOY09328.1| Pentatricopeptide repeat (PPR-like) superfamily p... 108 6e-22 ref|XP_002892169.1| pentatricopeptide repeat-containing protein ... 108 1e-21 ref|XP_006306944.1| hypothetical protein CARUB_v10008524mg [Caps... 107 1e-21 ref|XP_006418224.1| hypothetical protein EUTSA_v10007014mg [Eutr... 107 2e-21 ref|XP_004306013.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 gb|EMJ18185.1| hypothetical protein PRUPE_ppa002596mg [Prunus pe... 107 2e-21 ref|NP_171855.1| pentatricopeptide repeat-containing protein [Ar... 105 6e-21 dbj|BAF01006.1| hypothetical protein [Arabidopsis thaliana] 105 6e-21 ref|XP_004248470.1| PREDICTED: pentatricopeptide repeat-containi... 105 8e-21 ref|XP_006366006.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_004155527.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_004137016.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 gb|EOX99363.1| Pentatricopeptide repeat (PPR-like) superfamily p... 102 7e-20 ref|XP_006447324.1| hypothetical protein CICLE_v10014552mg [Citr... 99 8e-19 ref|XP_006371589.1| pentatricopeptide repeat-containing family p... 96 7e-18 ref|XP_002329409.1| predicted protein [Populus trichocarpa] 96 7e-18 ref|XP_004513160.1| PREDICTED: pentatricopeptide repeat-containi... 89 5e-16 gb|ACU28370.1| At1g03560-like protein [Arabidopsis lyrata subsp.... 89 6e-16 >ref|XP_002532772.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527482|gb|EEF29611.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 647 Score = 112 bits (279), Expect = 7e-23 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 2/88 (2%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVVSRQHK--QTSIWVPRIVELLDGSPLMEANLSEYCNKFL 296 F + SLPPPEWI+PF D+SDV SR H+ + S WV +I+ LLDGS ME+NL +C+ FL Sbjct: 44 FTSNSLPPPEWIDPFVDLSDVASRTHQDLKPSPWVNQILALLDGSSNMESNLDTFCHMFL 103 Query: 297 IRLTPNFVAFVLSSTQVQTNPDVAFRFF 380 I+L+P+FV+F+L ST++QT PDVA RFF Sbjct: 104 IKLSPSFVSFILRSTELQTKPDVAIRFF 131 >emb|CBI28908.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 111 bits (278), Expect = 9e-23 Identities = 63/144 (43%), Positives = 84/144 (58%), Gaps = 21/144 (14%) Frame = +3 Query: 12 MRKTIFLQKRFLSSLTLI------------NGVHHHFLSLPPYPKALNNFCT-------- 131 MRKT+ KRF + L+ +G+ H L PP+ L + T Sbjct: 1 MRKTLI--KRFSQAHLLLPFHSPQPPCPYNSGIFHPHLRPPPHASKLGSTSTVGSNSRWV 58 Query: 132 -TSLPPPEWIEPFTDISDVVSRQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLIRLT 308 T+ PPEW+EP D+SD+ S Q S WV +I++LLDGS ME+NL YC+KFLI+L+ Sbjct: 59 FTTPIPPEWVEPLYDLSDLASNPQPQPSPWVNQILKLLDGSVNMESNLDSYCSKFLIKLS 118 Query: 309 PNFVAFVLSSTQVQTNPDVAFRFF 380 PNFVAFVL S ++ PD+AFRFF Sbjct: 119 PNFVAFVLKSDAIRGKPDIAFRFF 142 >gb|EOY09328.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 654 Score = 108 bits (271), Expect = 6e-22 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 11/118 (9%) Frame = +3 Query: 60 LINGVHHHFLSLPPYPKALNN---------FCTTSLPPPEWIEPFTDISDVVSR--QHKQ 206 L++ + + S P PK L+N F + LPPPEWIEPF ++S + S Q Q Sbjct: 21 LLSSPYRNVESPPNPPKPLSNSISISSRFIFTPSYLPPPEWIEPFFNVSGLASTFPQDLQ 80 Query: 207 TSIWVPRIVELLDGSPLMEANLSEYCNKFLIRLTPNFVAFVLSSTQVQTNPDVAFRFF 380 S WV +IV LLDG ME+NL +C+KFLI+L+PNFVAFVL+S +VQ PDVA RFF Sbjct: 81 PSPWVSKIVNLLDGCSNMESNLDSFCHKFLIQLSPNFVAFVLASAEVQNKPDVALRFF 138 >ref|XP_002892169.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338011|gb|EFH68428.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 662 Score = 108 bits (269), Expect = 1e-21 Identities = 50/87 (57%), Positives = 68/87 (78%), Gaps = 1/87 (1%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVV-SRQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLI 299 F ++SLPPPEWIEPF D+SD+V S ++ Q S WV +I+ LLDGS ME+NL +C KFLI Sbjct: 53 FNSSSLPPPEWIEPFNDVSDLVKSNRNLQPSPWVSQILNLLDGSASMESNLDGFCRKFLI 112 Query: 300 RLTPNFVAFVLSSTQVQTNPDVAFRFF 380 +L+PNFV+FVL S +++ PD+A+ FF Sbjct: 113 KLSPNFVSFVLKSDEIREKPDIAWSFF 139 >ref|XP_006306944.1| hypothetical protein CARUB_v10008524mg [Capsella rubella] gi|482575655|gb|EOA39842.1| hypothetical protein CARUB_v10008524mg [Capsella rubella] Length = 663 Score = 107 bits (268), Expect = 1e-21 Identities = 50/87 (57%), Positives = 68/87 (78%), Gaps = 1/87 (1%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVV-SRQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLI 299 F + SLPPPEW+EPF D+SD+V S ++ Q S WV +I+ LLDGS ME+NL +C KFLI Sbjct: 54 FNSISLPPPEWVEPFNDVSDLVKSNRNLQPSPWVSQILNLLDGSDSMESNLDGFCRKFLI 113 Query: 300 RLTPNFVAFVLSSTQVQTNPDVAFRFF 380 +L+PNFV+FVL+S ++Q P +A+RFF Sbjct: 114 KLSPNFVSFVLNSDEIQEKPIIAWRFF 140 >ref|XP_006418224.1| hypothetical protein EUTSA_v10007014mg [Eutrema salsugineum] gi|557095995|gb|ESQ36577.1| hypothetical protein EUTSA_v10007014mg [Eutrema salsugineum] Length = 661 Score = 107 bits (267), Expect = 2e-21 Identities = 52/87 (59%), Positives = 67/87 (77%), Gaps = 1/87 (1%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVV-SRQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLI 299 F ++SLPPPEWIEPF D+SD+V S + Q S WV +I+ LLDGS ME+NL +C KFLI Sbjct: 53 FSSSSLPPPEWIEPFNDVSDLVKSTGNLQPSPWVSQILNLLDGSDSMESNLDGFCRKFLI 112 Query: 300 RLTPNFVAFVLSSTQVQTNPDVAFRFF 380 +L+PNFVAFVL S +++ P VA+RFF Sbjct: 113 KLSPNFVAFVLKSDEIREIPGVAWRFF 139 >ref|XP_004306013.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 656 Score = 107 bits (266), Expect = 2e-21 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 2/86 (2%) Frame = +3 Query: 129 TTSLPPPEWIEPFTDISDVVSRQHK-QTSIWVPRIVELLDG-SPLMEANLSEYCNKFLIR 302 T SLPPPEW+EPF D+SDV+S H+ S WVP+I+ LLD SP ME NL YC KFLI+ Sbjct: 55 TNSLPPPEWVEPFHDVSDVISSPHRFDPSPWVPQILNLLDNNSPQMEHNLDSYCRKFLIK 114 Query: 303 LTPNFVAFVLSSTQVQTNPDVAFRFF 380 L+PNFVA+VL S ++ P+ A RFF Sbjct: 115 LSPNFVAYVLKSDNLRDKPETALRFF 140 >gb|EMJ18185.1| hypothetical protein PRUPE_ppa002596mg [Prunus persica] Length = 654 Score = 107 bits (266), Expect = 2e-21 Identities = 50/85 (58%), Positives = 63/85 (74%), Gaps = 1/85 (1%) Frame = +3 Query: 129 TTSLPPPEWIEPFTDISDVVSR-QHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLIRL 305 T SLPPPEW+EPF D+SD+VS Q S WV +I+ LLDGS MEANL YC+ FLI+L Sbjct: 54 TNSLPPPEWVEPFNDVSDIVSNPQDFDPSPWVAQILNLLDGSQKMEANLDSYCHTFLIKL 113 Query: 306 TPNFVAFVLSSTQVQTNPDVAFRFF 380 +PNFVA+VL S +++ P+ A RFF Sbjct: 114 SPNFVAYVLKSAELRGKPETALRFF 138 >ref|NP_171855.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180297|sp|Q9LR67.1|PPR9_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g03560, mitochondrial; Flags: Precursor gi|9280662|gb|AAF86531.1|AC002560_24 F21B7.18 [Arabidopsis thaliana] gi|332189465|gb|AEE27586.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 660 Score = 105 bits (262), Expect = 6e-21 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVV-SRQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLI 299 F ++SLPPPEWIEPF D+SD+V S ++ S WV +I+ LLDGS ME+NL +C KFLI Sbjct: 53 FNSSSLPPPEWIEPFNDVSDLVKSNRNLLPSPWVSQILNLLDGSASMESNLDGFCRKFLI 112 Query: 300 RLTPNFVAFVLSSTQVQTNPDVAFRFF 380 +L+PNFV+FVL S +++ PD+A+ FF Sbjct: 113 KLSPNFVSFVLKSDEIREKPDIAWSFF 139 >dbj|BAF01006.1| hypothetical protein [Arabidopsis thaliana] Length = 642 Score = 105 bits (262), Expect = 6e-21 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 1/87 (1%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVV-SRQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLI 299 F ++SLPPPEWIEPF D+SD+V S ++ S WV +I+ LLDGS ME+NL +C KFLI Sbjct: 35 FNSSSLPPPEWIEPFNDVSDLVKSNRNLLPSPWVSQILNLLDGSASMESNLDGFCRKFLI 94 Query: 300 RLTPNFVAFVLSSTQVQTNPDVAFRFF 380 +L+PNFV+FVL S +++ PD+A+ FF Sbjct: 95 KLSPNFVSFVLKSDEIREKPDIAWSFF 121 >ref|XP_004248470.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Solanum lycopersicum] Length = 711 Score = 105 bits (261), Expect = 8e-21 Identities = 49/87 (56%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVVS-RQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLI 299 F ++LPPPEW++PF D+SD+V+ R+ + S WV +I+ LLD SPLME NL YC KFLI Sbjct: 109 FTGSNLPPPEWVQPFVDLSDLVTDRKDLKPSPWVSQILNLLDNSPLMEQNLDVYCCKFLI 168 Query: 300 RLTPNFVAFVLSSTQVQTNPDVAFRFF 380 +L+P+FVA+VL S + PD+AFRFF Sbjct: 169 KLSPSFVAYVLKSDYLTGKPDIAFRFF 195 >ref|XP_006366006.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565401005|ref|XP_006366007.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565401007|ref|XP_006366008.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X3 [Solanum tuberosum] gi|565401009|ref|XP_006366009.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X4 [Solanum tuberosum] gi|565401011|ref|XP_006366010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X5 [Solanum tuberosum] Length = 711 Score = 103 bits (257), Expect = 2e-20 Identities = 48/84 (57%), Positives = 65/84 (77%), Gaps = 1/84 (1%) Frame = +3 Query: 132 TSLPPPEWIEPFTDISDVVS-RQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLIRLT 308 ++LPPPEW++PF D+SD+V+ R+ + S WV +I+ LLD SPLME NL YC KFLI+L+ Sbjct: 112 SNLPPPEWVQPFIDLSDLVTDRKDLKPSPWVSQILNLLDNSPLMEQNLDVYCCKFLIKLS 171 Query: 309 PNFVAFVLSSTQVQTNPDVAFRFF 380 P+FVA+VL S + PD+AFRFF Sbjct: 172 PSFVAYVLKSDYLTGKPDIAFRFF 195 >ref|XP_004155527.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Cucumis sativus] Length = 653 Score = 103 bits (257), Expect = 2e-20 Identities = 49/87 (56%), Positives = 61/87 (70%), Gaps = 1/87 (1%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVVSR-QHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLI 299 F T LPPPEWIEPF D+SDV+S Q S WV +I+ LLDGS ME NL +C KF + Sbjct: 51 FTNTLLPPPEWIEPFVDVSDVISSSQPLDPSPWVAQILNLLDGSSNMEHNLDSFCRKFFV 110 Query: 300 RLTPNFVAFVLSSTQVQTNPDVAFRFF 380 +L+PNFV FVL S +++ P+VA RFF Sbjct: 111 KLSPNFVTFVLQSVELREKPEVAVRFF 137 >ref|XP_004137016.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Cucumis sativus] Length = 651 Score = 103 bits (257), Expect = 2e-20 Identities = 49/87 (56%), Positives = 61/87 (70%), Gaps = 1/87 (1%) Frame = +3 Query: 123 FCTTSLPPPEWIEPFTDISDVVSR-QHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLI 299 F T LPPPEWIEPF D+SDV+S Q S WV +I+ LLDGS ME NL +C KF + Sbjct: 49 FTNTLLPPPEWIEPFVDVSDVISSSQPLDPSPWVAQILNLLDGSSNMEHNLDSFCRKFFV 108 Query: 300 RLTPNFVAFVLSSTQVQTNPDVAFRFF 380 +L+PNFV FVL S +++ P+VA RFF Sbjct: 109 KLSPNFVTFVLQSVELREKPEVAVRFF 135 >gb|EOX99363.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 621 Score = 102 bits (253), Expect = 7e-20 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 17/139 (12%) Frame = +3 Query: 12 MRKTIFLQKRFLSSLT-----LINGVHHHFLSLPPYPKALNN----------FCTTSLPP 146 MR+T+ L+ + SL+ L++ H + S P K L+N F ++LPP Sbjct: 1 MRRTL-LKPLYPGSLSRLQSPLLSSPHRNVESPPNPLKLLSNPISISSSRFIFTPSNLPP 59 Query: 147 PEWIEPFTDISDVVS--RQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLIRLTPNFV 320 PEWIEPF +S + S + Q S WV +IV LLDGS ME NL +C+KF I+L+PNFV Sbjct: 60 PEWIEPFFKVSGLASIFPRDLQPSPWVSKIVNLLDGSSNMELNLYSFCHKFSIQLSPNFV 119 Query: 321 AFVLSSTQVQTNPDVAFRF 377 AFVL+S +VQ PDVA RF Sbjct: 120 AFVLASVEVQNKPDVALRF 138 >ref|XP_006447324.1| hypothetical protein CICLE_v10014552mg [Citrus clementina] gi|568877202|ref|XP_006491635.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Citrus sinensis] gi|557549935|gb|ESR60564.1| hypothetical protein CICLE_v10014552mg [Citrus clementina] Length = 650 Score = 98.6 bits (244), Expect = 8e-19 Identities = 49/93 (52%), Positives = 64/93 (68%), Gaps = 1/93 (1%) Frame = +3 Query: 105 PKALNNFCTTSLPPPEWIEPFTDISDVVS-RQHKQTSIWVPRIVELLDGSPLMEANLSEY 281 P++ N+F PPPEW+EPF D+SD+VS Q+ S WV +I+ LLDGS MEANL + Sbjct: 47 PRSANSF-----PPPEWVEPFNDVSDLVSCPQNLNPSPWVRQILNLLDGSSDMEANLDSF 101 Query: 282 CNKFLIRLTPNFVAFVLSSTQVQTNPDVAFRFF 380 C KFLI+L+PNFV+FVL + V P+V R F Sbjct: 102 CRKFLIKLSPNFVSFVLRNHDVSKRPNVGLRLF 134 >ref|XP_006371589.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317468|gb|ERP49386.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 659 Score = 95.5 bits (236), Expect = 7e-18 Identities = 47/84 (55%), Positives = 62/84 (73%), Gaps = 3/84 (3%) Frame = +3 Query: 138 LPPPEWIEPFTDISDVVSR--QHKQTSIWVPRIVELL-DGSPLMEANLSEYCNKFLIRLT 308 LPPPEWIEPF D+SD+ S+ Q + S WV +I+ LL DG ME+ L +CNKFLI+L+ Sbjct: 60 LPPPEWIEPFNDLSDIASKPPQDLKPSPWVHQIMSLLLDGPVDMESRLDLFCNKFLIKLS 119 Query: 309 PNFVAFVLSSTQVQTNPDVAFRFF 380 PNFV+FVL S ++Q PD+A +FF Sbjct: 120 PNFVSFVLKSMELQKRPDLALKFF 143 >ref|XP_002329409.1| predicted protein [Populus trichocarpa] Length = 599 Score = 95.5 bits (236), Expect = 7e-18 Identities = 47/84 (55%), Positives = 62/84 (73%), Gaps = 3/84 (3%) Frame = +3 Query: 138 LPPPEWIEPFTDISDVVSR--QHKQTSIWVPRIVELL-DGSPLMEANLSEYCNKFLIRLT 308 LPPPEWIEPF D+SD+ S+ Q + S WV +I+ LL DG ME+ L +CNKFLI+L+ Sbjct: 1 LPPPEWIEPFNDLSDIASKPPQDLKPSPWVHQIMSLLLDGPVDMESRLDLFCNKFLIKLS 60 Query: 309 PNFVAFVLSSTQVQTNPDVAFRFF 380 PNFV+FVL S ++Q PD+A +FF Sbjct: 61 PNFVSFVLKSMELQKRPDLALKFF 84 >ref|XP_004513160.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Cicer arietinum] Length = 649 Score = 89.4 bits (220), Expect = 5e-16 Identities = 55/131 (41%), Positives = 74/131 (56%), Gaps = 8/131 (6%) Frame = +3 Query: 12 MRKTIFLQKRFLSSLTLINGVHHHF-------LSLPPYPKALNNFCTTSLPPPEWIEPFT 170 MR+ FL + SL+ I+ + F PP L +F + LPPPE +EP+ Sbjct: 1 MRRIPFLLLKQRPSLSTISKISLSFPLPQPLQTQSPPSHSFLRSFKSLPLPPPELVEPYC 60 Query: 171 DISDVVS-RQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLIRLTPNFVAFVLSSTQV 347 D+SDVVS +Q+ Q S W +I+ LLD SP ME NL+ +C +FLI L+P+FVA L S Sbjct: 61 DLSDVVSSKQNLQPSPWFTQILNLLDNSPTMELNLNSFCQQFLITLSPSFVAHTLRSL-- 118 Query: 348 QTNPDVAFRFF 380 N A RFF Sbjct: 119 -NNHHTALRFF 128 >gb|ACU28370.1| At1g03560-like protein [Arabidopsis lyrata subsp. petraea] gi|255685764|gb|ACU28371.1| At1g03560-like protein [Arabidopsis lyrata subsp. petraea] gi|255685766|gb|ACU28372.1| At1g03560-like protein [Arabidopsis lyrata subsp. petraea] gi|255685768|gb|ACU28373.1| At1g03560-like protein [Arabidopsis lyrata subsp. petraea] gi|255685772|gb|ACU28375.1| At1g03560-like protein [Arabidopsis lyrata subsp. petraea] gi|255685774|gb|ACU28376.1| At1g03560-like protein [Arabidopsis lyrata subsp. petraea] gi|255685776|gb|ACU28377.1| At1g03560-like protein [Arabidopsis lyrata subsp. petraea] Length = 121 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 1/76 (1%) Frame = +3 Query: 156 IEPFTDISDVV-SRQHKQTSIWVPRIVELLDGSPLMEANLSEYCNKFLIRLTPNFVAFVL 332 IEPF D+SD+V S ++ Q S WV +I+ LLDGS ME+NL +C KFLI+L+PNFV+FVL Sbjct: 1 IEPFNDVSDLVKSNRNLQPSPWVSQILNLLDGSASMESNLDGFCRKFLIKLSPNFVSFVL 60 Query: 333 SSTQVQTNPDVAFRFF 380 S +++ PD+A+ FF Sbjct: 61 KSDEIREKPDIAWSFF 76