BLASTX nr result
ID: Achyranthes23_contig00045459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00045459 (222 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006412580.1| hypothetical protein EUTSA_v10024180mg [Eutr... 56 6e-06 ref|XP_002515356.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_006412580.1| hypothetical protein EUTSA_v10024180mg [Eutrema salsugineum] gi|557113750|gb|ESQ54033.1| hypothetical protein EUTSA_v10024180mg [Eutrema salsugineum] Length = 2723 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/79 (43%), Positives = 45/79 (56%), Gaps = 7/79 (8%) Frame = -1 Query: 222 NDKKSLQQKIDNFESYCGSLSADLENSQQ-------HMRSVKQKIENLENYCESLSNDLE 64 +DK +LQQKIDN E YC SLSADLE SQ+ +++SV + NL E+L+ D E Sbjct: 1586 HDKNTLQQKIDNLEVYCQSLSADLEVSQKQVCDVEANLQSVDNERANLSERLETLNGDHE 1645 Query: 63 ESQNRIYELESSLEATLNE 7 R +LE E N+ Sbjct: 1646 NLSARAIDLEVENEKLQNQ 1664 >ref|XP_002515356.1| conserved hypothetical protein [Ricinus communis] gi|223545300|gb|EEF46805.1| conserved hypothetical protein [Ricinus communis] Length = 1934 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/74 (41%), Positives = 43/74 (58%) Frame = -1 Query: 222 NDKKSLQQKIDNFESYCGSLSADLENSQQHMRSVKQKIENLENYCESLSNDLEESQNRIY 43 +DK SL Q I E +CGSL+ADLE SQ+ + SL+ +L+ESQ RI Sbjct: 1387 HDKNSLLQNIGKLEDHCGSLAADLEESQKRI--------------SSLNAELKESQKRIS 1432 Query: 42 ELESSLEATLNEKE 1 +LE ++A + EKE Sbjct: 1433 DLEKDIQAVIQEKE 1446