BLASTX nr result
ID: Achyranthes23_contig00045451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00045451 (259 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABP01543.1| UPF2, partial [Nicotiana attenuata] 57 3e-06 >gb|ABP01543.1| UPF2, partial [Nicotiana attenuata] Length = 369 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +1 Query: 1 AFVPAVLLGEADSKVSEQLAKMQDHSPDAGTEPDLLHTVTEDTDESSLDSGAV 159 AFVPAVLLGEA+ K SEQ K Q+HS D+ +E D T +T E ++D+GAV Sbjct: 250 AFVPAVLLGEAEPKSSEQPLKAQEHSIDSASEADEAQTAAVETAEGAVDAGAV 302