BLASTX nr result
ID: Achyranthes23_contig00045397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00045397 (324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF64449.1|AF239927_1 glutathione S-transferase [Euphorbia es... 72 8e-11 emb|CBI34681.3| unnamed protein product [Vitis vinifera] 69 9e-10 ref|XP_002272455.1| PREDICTED: glutathione S-transferase T1 [Vit... 69 9e-10 ref|XP_002509786.1| glutathione-s-transferase theta, gst, putati... 67 2e-09 ref|XP_002298040.2| glutathione S-transferase family protein [Po... 67 3e-09 gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populu... 67 3e-09 ref|XP_002304489.1| glutathione S-transferase family protein [Po... 66 6e-09 gb|ACC93946.1| glutathione S-transferase [Panax ginseng] 66 6e-09 ref|XP_006476596.1| PREDICTED: glutathione S-transferase T1-like... 65 7e-09 ref|XP_006439583.1| hypothetical protein CICLE_v10021831mg [Citr... 65 7e-09 ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citr... 65 7e-09 ref|XP_006579425.1| PREDICTED: uncharacterized protein LOC100799... 65 1e-08 gb|AEB77874.1| glutathione S-transferase protein [Bruguiera gymn... 65 1e-08 ref|XP_002509785.1| glutathione-s-transferase theta, gst, putati... 65 1e-08 gb|AFK36240.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_002298039.1| predicted protein [Populus trichocarpa] 64 2e-08 gb|EMT22242.1| hypothetical protein F775_32578 [Aegilops tauschii] 64 2e-08 gb|EMS35634.1| Glutathione S-transferase theta-1 [Triticum urartu] 64 2e-08 ref|XP_002509787.1| glutathione-s-transferase theta, gst, putati... 64 2e-08 ref|XP_003630527.1| Glutathione S-transferase theta [Medicago tr... 63 4e-08 >gb|AAF64449.1|AF239927_1 glutathione S-transferase [Euphorbia esula] Length = 238 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIA 183 QL L E++RKR++GP+KKVQQW+ED K ATNPHFDEVH+ LF A Sbjct: 178 QLEFLEEDDRKRILGPFKKVQQWIEDTKIATNPHFDEVHETLFQARA 224 >emb|CBI34681.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIASFNQNP 165 QL +L + ER R++GPYKKVQQW+E+ K AT PHFDEVH LF A + P Sbjct: 178 QLEILGDRERNRILGPYKKVQQWIENTKNATRPHFDEVHALLFGFKARLQKPP 230 >ref|XP_002272455.1| PREDICTED: glutathione S-transferase T1 [Vitis vinifera] Length = 248 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIASFNQNP 165 QL +L + ER R++GPYKKVQQW+E+ K AT PHFDEVH LF A + P Sbjct: 178 QLEILGDRERNRILGPYKKVQQWIENTKNATRPHFDEVHALLFGFKARLQKPP 230 >ref|XP_002509786.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi|223549685|gb|EEF51173.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] Length = 237 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIASFNQ 171 QL +L E++R R++ PYKKV+QW+E+VKEAT+PHFDEVH L+ A Q Sbjct: 178 QLEILDEDDRHRLLEPYKKVKQWIENVKEATSPHFDEVHDTLYKFSAMLKQ 228 >ref|XP_002298040.2| glutathione S-transferase family protein [Populus trichocarpa] gi|550346875|gb|EEE82845.2| glutathione S-transferase family protein [Populus trichocarpa] Length = 247 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLF 195 QL +L E++ R++ PYKKVQQWMED K AT PHFDEVHQ LF Sbjct: 178 QLEVLDEKDCSRILCPYKKVQQWMEDTKNATRPHFDEVHQILF 220 >gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populus trichocarpa] Length = 247 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLF 195 QL +L E++ R++ PYKKVQQWMED K AT PHFDEVHQ LF Sbjct: 178 QLEVLDEKDCSRILCPYKKVQQWMEDTKNATRPHFDEVHQILF 220 >ref|XP_002304489.1| glutathione S-transferase family protein [Populus trichocarpa] gi|222841921|gb|EEE79468.1| glutathione S-transferase family protein [Populus trichocarpa] Length = 232 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLF 195 QL E +R R++GP+KK+QQW+ED K AT PHFDEVHQ LF Sbjct: 179 QLEFTDETDRNRILGPHKKIQQWIEDTKNATKPHFDEVHQALF 221 >gb|ACC93946.1| glutathione S-transferase [Panax ginseng] Length = 250 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIA 183 QL +L E +R R++GP+KKV QW+ED K+AT PHFDE+H+ LF + A Sbjct: 178 QLELLDERDRDRILGPHKKVLQWVEDTKKATRPHFDEIHELLFKLKA 224 >ref|XP_006476596.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis] Length = 252 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDV 189 +L +L EE+R R++GP+KKVQ+W+E + AT PHFDEVH+ LF V Sbjct: 178 ELELLDEEDRTRLLGPHKKVQEWIESTRRATRPHFDEVHKVLFKV 222 >ref|XP_006439583.1| hypothetical protein CICLE_v10021831mg [Citrus clementina] gi|557541845|gb|ESR52823.1| hypothetical protein CICLE_v10021831mg [Citrus clementina] Length = 252 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDV 189 +L +L EE+R R++GP+KKVQ+W+E + AT PHFDEVH+ LF V Sbjct: 178 ELELLDEEDRTRLLGPHKKVQEWIESTRRATRPHFDEVHKVLFKV 222 >ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citrus clementina] gi|568845464|ref|XP_006476593.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis] gi|557541844|gb|ESR52822.1| hypothetical protein CICLE_v10021879mg [Citrus clementina] Length = 247 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDV 189 QL +L EE+R ++GP+KKVQQW+E K AT PHFDEVH+ LF V Sbjct: 178 QLELLDEEDRIGLMGPHKKVQQWIESTKNATRPHFDEVHEVLFKV 222 >ref|XP_006579425.1| PREDICTED: uncharacterized protein LOC100799229 isoform X1 [Glycine max] Length = 252 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIASFNQ 171 QL +L E++R R++ PYKKV QW+ED + ATNPHF+EVH L+ F Q Sbjct: 180 QLEVLDEKDRSRILSPYKKVLQWIEDTRTATNPHFEEVHNILYRAKKKFEQ 230 >gb|AEB77874.1| glutathione S-transferase protein [Bruguiera gymnorhiza] Length = 250 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFD 192 QL +L +++R R++GP+KKVQQW+E K+AT PHFDEVH+ L++ Sbjct: 178 QLEILDDKDRNRLLGPHKKVQQWIESTKKATRPHFDEVHKTLYE 221 >ref|XP_002509785.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi|223549684|gb|EEF51172.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] Length = 250 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLF 195 QL +L E++ R++GP+KKVQQW+ED+K T PHFDEVH+ LF Sbjct: 178 QLEVLDEKDCNRILGPHKKVQQWIEDIKRVTRPHFDEVHKVLF 220 >gb|AFK36240.1| unknown [Lotus japonicus] Length = 251 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLF 195 QL +L E++R R++GP+KKVQQW+E K AT PHFDEVH L+ Sbjct: 179 QLELLDEKDRDRILGPHKKVQQWIESTKNATRPHFDEVHNVLY 221 >ref|XP_002298039.1| predicted protein [Populus trichocarpa] Length = 95 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLF 195 QL + E E ++GP+KKVQQW+ED K AT PHFDEVHQ LF Sbjct: 43 QLQFVDETESNHILGPFKKVQQWIEDTKNATRPHFDEVHQTLF 85 >gb|EMT22242.1| hypothetical protein F775_32578 [Aegilops tauschii] Length = 242 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIASFN 174 QL ++ +E R R++GP+ KV+ WME+VK+AT+PHFDEVH+ +F + A N Sbjct: 187 QLEVVGDERRDRILGPHDKVRAWMENVKKATSPHFDEVHELIFKLKARLN 236 >gb|EMS35634.1| Glutathione S-transferase theta-1 [Triticum urartu] Length = 233 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIASFN 174 QL ++ +E R R++GP+ KV+ WME+VK+AT+PHFDEVH+ +F + A N Sbjct: 179 QLEVVGDERRDRILGPHDKVRAWMENVKKATSPHFDEVHELIFKLKARLN 228 >ref|XP_002509787.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi|223549686|gb|EEF51174.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] Length = 238 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIASFNQ 171 QL +L E +R R +GP+KKVQQW+E++K+AT+ HFDEVH L+ A Q Sbjct: 179 QLEVLDENDRNRFLGPHKKVQQWIENIKKATSSHFDEVHDTLYKFSAMLKQ 229 >ref|XP_003630527.1| Glutathione S-transferase theta [Medicago truncatula] gi|355524549|gb|AET05003.1| Glutathione S-transferase theta [Medicago truncatula] Length = 251 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -2 Query: 323 QLHMLSEEERKRMIGPYKKVQQWMEDVKEATNPHFDEVHQYLFDVIASFNQ 171 QL +L E++R R++ PYKKV QW+ED + ATNPHF+EVH L+ F Q Sbjct: 179 QLEVLDEKDRDRILFPYKKVLQWIEDTRTATNPHFEEVHNILYRAKKKFQQ 229