BLASTX nr result
ID: Achyranthes23_contig00045331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00045331 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006480118.1| PREDICTED: proline-rich protein 3-like [Citr... 82 6e-14 gb|EOX95155.1| Pollen Ole e 1 allergen and extensin family prote... 80 3e-13 ref|XP_006444408.1| hypothetical protein CICLE_v10023460mg [Citr... 79 5e-13 ref|XP_004290820.1| PREDICTED: proline-rich protein 3-like [Frag... 79 5e-13 gb|EMJ02298.1| hypothetical protein PRUPE_ppa024679mg [Prunus pe... 77 2e-12 ref|XP_006397949.1| hypothetical protein EUTSA_v10001657mg [Eutr... 76 4e-12 ref|XP_002523122.1| structural constituent of cell wall, putativ... 76 5e-12 ref|XP_002880311.1| pollen ole e 1 allergen and extensin family ... 75 9e-12 ref|XP_002302729.1| pollen Ole e 1 allergen and extensin family ... 75 1e-11 gb|ESW17189.1| hypothetical protein PHAVU_007G218200g [Phaseolus... 74 2e-11 gb|EOY03777.1| Pollen Ole e 1 allergen and extensin family prote... 74 2e-11 ref|XP_004292084.1| PREDICTED: proline-rich protein 3-like [Frag... 74 2e-11 ref|XP_006295080.1| hypothetical protein CARUB_v10024151mg [Caps... 73 3e-11 ref|XP_003536042.1| PREDICTED: proline-rich protein 3-like [Glyc... 73 3e-11 ref|NP_182276.1| pollen Ole e 1 allergen and extensin family pro... 73 5e-11 ref|XP_003591486.1| hypothetical protein MTR_1g088110 [Medicago ... 71 1e-10 ref|XP_004247533.1| PREDICTED: uncharacterized protein LOC101257... 70 3e-10 ref|XP_004495936.1| PREDICTED: proline-rich protein 3-like [Cice... 70 4e-10 ref|XP_003591488.1| Pistil-specific extensin-like protein [Medic... 70 4e-10 ref|XP_002523123.1| structural constituent of cell wall, putativ... 70 4e-10 >ref|XP_006480118.1| PREDICTED: proline-rich protein 3-like [Citrus sinensis] Length = 180 Score = 82.4 bits (202), Expect = 6e-14 Identities = 46/101 (45%), Positives = 60/101 (59%), Gaps = 2/101 (1%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYSSPKYS-FKNCKVFLDEASHGDY 231 R+TC D+HGYE+APFS+ + TD KGYF L+ +S K CK FL E S Sbjct: 73 RITCLANDEHGYEAAPFSILSDATDAKGYFFATLSPSEVENFSRLKECKAFL-ELSPSKT 131 Query: 230 CSVPTNTNNGISGATPAKPRRLS-GNYVLFSVGPFAFIPSS 111 C+VPTN NNG +GA + R L+ +LFSV PF + +S Sbjct: 132 CNVPTNINNGTAGALLSSYRTLNKSKMILFSVPPFFYRSNS 172 >gb|EOX95155.1| Pollen Ole e 1 allergen and extensin family protein, putative [Theobroma cacao] Length = 237 Score = 80.1 bits (196), Expect = 3e-13 Identities = 45/99 (45%), Positives = 58/99 (58%), Gaps = 2/99 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 R+TC+ DK+GYE+ FS+ + TD KGYF+ ++ Y + CK FL E S D Sbjct: 128 RITCQGVDKYGYETESFSILSCATDAKGYFIATVSPYEVKDSRRLRECKAFL-ELSPSDA 186 Query: 230 CSVPTNTNNGISGATPAKPRRL-SGNYVLFSVGPFAFIP 117 C VPT+ N GI+GA A L N LF+VGPF FIP Sbjct: 187 CDVPTDVNQGITGAPLASYHLLHDKNMKLFTVGPFFFIP 225 >ref|XP_006444408.1| hypothetical protein CICLE_v10023460mg [Citrus clementina] gi|557546670|gb|ESR57648.1| hypothetical protein CICLE_v10023460mg [Citrus clementina] Length = 180 Score = 79.3 bits (194), Expect = 5e-13 Identities = 45/101 (44%), Positives = 59/101 (58%), Gaps = 2/101 (1%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYSSPKYS-FKNCKVFLDEASHGDY 231 R+TC D+HGYE+APFS+ + TD KGYF L+ +S K CK FL E S Sbjct: 73 RITCLANDEHGYEAAPFSILSDATDAKGYFFATLSPSEVENFSRLKECKAFL-ELSPSKT 131 Query: 230 CSVPTNTNNGISGATPAKPRRLS-GNYVLFSVGPFAFIPSS 111 C+VPTN NN +GA + R L+ +LFSV PF + +S Sbjct: 132 CNVPTNINNWTAGALLSSYRTLNKSKMILFSVPPFFYRSNS 172 >ref|XP_004290820.1| PREDICTED: proline-rich protein 3-like [Fragaria vesca subsp. vesca] Length = 210 Score = 79.3 bits (194), Expect = 5e-13 Identities = 46/101 (45%), Positives = 61/101 (60%), Gaps = 6/101 (5%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-----SPKYSFKNCKVFLDEAS 243 R+TC +D++GYE+APFS+ TD KGYF L+ + K+ CK FLD +S Sbjct: 100 RITCVGEDENGYETAPFSMLAGATDAKGYFFATLSPSKLEDSYNKKWKLTECKAFLD-SS 158 Query: 242 HGDYCSVPTNTNNGISGATPAKPRRLSG-NYVLFSVGPFAF 123 + C VPT+ N+GISGA A R L+ N LFSVGPF + Sbjct: 159 PLESCKVPTDANHGISGAPLASYRTLNAKNMKLFSVGPFFY 199 >gb|EMJ02298.1| hypothetical protein PRUPE_ppa024679mg [Prunus persica] Length = 194 Score = 77.0 bits (188), Expect = 2e-12 Identities = 42/97 (43%), Positives = 59/97 (60%), Gaps = 2/97 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 R+TC +D++GYE+APFS+ + TD KGYF L+ K+ CK FLD S Y Sbjct: 85 RITCLAEDEYGYETAPFSILSGATDAKGYFFATLSPSELQDKWKLTECKAFLD-YSPFQY 143 Query: 230 CSVPTNTNNGISGATPAKPRRLSGNYV-LFSVGPFAF 123 C VPT+ N+GI+G A R ++ + L+SVGPF + Sbjct: 144 CQVPTDVNHGITGHLLASYRIINTKKIKLYSVGPFFY 180 >ref|XP_006397949.1| hypothetical protein EUTSA_v10001657mg [Eutrema salsugineum] gi|557099022|gb|ESQ39402.1| hypothetical protein EUTSA_v10001657mg [Eutrema salsugineum] Length = 173 Score = 76.3 bits (186), Expect = 4e-12 Identities = 46/102 (45%), Positives = 54/102 (52%), Gaps = 5/102 (4%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYSSPKYS---FKNCKVFLDEASHG 237 RVTCE D++GYE +V + TD KGYFL L+ Y K C+ F+ E S Sbjct: 60 RVTCETADEYGYEGEDVTVLSQATDAKGYFLATLSPSEVKDYQKVRIKECRAFV-ELSPA 118 Query: 236 DYCSVPTNTNNGISGATPAKPRRLSG--NYVLFSVGPFAFIP 117 D CS PT N GISGA K R L LF+VGPF F P Sbjct: 119 DTCSFPTEINRGISGAILQKYRLLENKIKMKLFTVGPFVFSP 160 >ref|XP_002523122.1| structural constituent of cell wall, putative [Ricinus communis] gi|223537684|gb|EEF39307.1| structural constituent of cell wall, putative [Ricinus communis] Length = 178 Score = 75.9 bits (185), Expect = 5e-12 Identities = 41/97 (42%), Positives = 59/97 (60%), Gaps = 2/97 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 R+TC D++G+E+AP+S+ + TD KGYFL L+ K K CK FL+ + + Sbjct: 71 RITCLTTDEYGHEAAPWSILSGATDAKGYFLATLSPSEVEDKMKIKECKAFLETSPSLET 130 Query: 230 CSVPTNTNNGISGATPAKPRRLS-GNYVLFSVGPFAF 123 C+VPT+ N GI+GA A L+ N LF+VGPF + Sbjct: 131 CNVPTDINKGITGAPLASYNFLTHKNMKLFTVGPFFY 167 >ref|XP_002880311.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis lyrata subsp. lyrata] gi|297326150|gb|EFH56570.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis lyrata subsp. lyrata] Length = 174 Score = 75.1 bits (183), Expect = 9e-12 Identities = 46/104 (44%), Positives = 54/104 (51%), Gaps = 7/104 (6%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAK-----YSSPKYSFKNCKVFLDEAS 243 RVTCE D++GYE+ +V + TD KGYFL L+ Y K C+ FL E S Sbjct: 60 RVTCERADEYGYEAEDVTVLSQATDAKGYFLATLSSSEVKDYKKQVMKIKECRAFL-ELS 118 Query: 242 HGDYCSVPTNTNNGISGATPAKPRRLSG--NYVLFSVGPFAFIP 117 D CS PT N GISGA R L LF+VGPF F P Sbjct: 119 PSDTCSFPTEINRGISGAILQNYRLLENKLKMKLFTVGPFVFSP 162 >ref|XP_002302729.1| pollen Ole e 1 allergen and extensin family protein [Populus trichocarpa] gi|222844455|gb|EEE82002.1| pollen Ole e 1 allergen and extensin family protein [Populus trichocarpa] Length = 179 Score = 74.7 bits (182), Expect = 1e-11 Identities = 43/97 (44%), Positives = 54/97 (55%), Gaps = 2/97 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 R+TC D +GYE+APFS + TD KGYF L+ Y K CK FL E S + Sbjct: 74 RITCLANDVYGYEAAPFSFLSEATDAKGYFFATLSPYEMQDNLKIKECKAFL-ELSPLET 132 Query: 230 CSVPTNTNNGISGATPAKPRRLSGNYV-LFSVGPFAF 123 C +PT+ GISGA A LS + LF+VGPF + Sbjct: 133 CKIPTDEKQGISGALLASYHYLSDKKMKLFTVGPFVY 169 >gb|ESW17189.1| hypothetical protein PHAVU_007G218200g [Phaseolus vulgaris] Length = 180 Score = 74.3 bits (181), Expect = 2e-11 Identities = 44/100 (44%), Positives = 58/100 (58%), Gaps = 2/100 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLA-KYSSPKYSFKNCKVFLDEASHGDY 231 R+TCE D+ G+E+ PFS + TD KGYFL L + + + K C+ LD AS + Sbjct: 73 RITCEAVDEDGFETTPFSFLSEETDSKGYFLATLCPREVAENHVLKECRACLD-ASPLNN 131 Query: 230 CSVPTNTNNGISGATPAKPRRL-SGNYVLFSVGPFAFIPS 114 CS T+ N GISGA PR L + N L++VGPF F S Sbjct: 132 CSYATDVNQGISGALLHSPRFLHNKNMKLYTVGPFLFTSS 171 >gb|EOY03777.1| Pollen Ole e 1 allergen and extensin family protein, putative [Theobroma cacao] Length = 182 Score = 73.9 bits (180), Expect = 2e-11 Identities = 43/97 (44%), Positives = 57/97 (58%), Gaps = 2/97 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 R+TC D+HGYE+APFS+ + TD KGY+ L + S K CK FL E S + Sbjct: 76 RITCLAVDEHGYETAPFSILSKATDSKGYYFATLFPHELSNKLKLTECKAFL-EKSPLEN 134 Query: 230 CSVPTNTNNGISGATPAKPRRLSGNYV-LFSVGPFAF 123 C V T+ N GISGA + R L+ N + L+SV PF + Sbjct: 135 CKVATDVNKGISGAPLSYCRLLNNNKMKLYSVPPFIY 171 >ref|XP_004292084.1| PREDICTED: proline-rich protein 3-like [Fragaria vesca subsp. vesca] Length = 236 Score = 73.9 bits (180), Expect = 2e-11 Identities = 43/101 (42%), Positives = 58/101 (57%), Gaps = 6/101 (5%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-----SPKYSFKNCKVFLDEAS 243 R+ C +D+HGYE+AP + + TD KGYF L+ + K+ F C FL +S Sbjct: 126 RIKCLGEDEHGYETAPLIILSGATDAKGYFFATLSASKLEGNYNKKWKFSKCTAFL-HSS 184 Query: 242 HGDYCSVPTNTNNGISGATPAKPRRLSG-NYVLFSVGPFAF 123 + C VPT+ N+GISGA A R L+ N LFSVGPF + Sbjct: 185 PLESCKVPTDVNHGISGAPLASCRTLNAKNMKLFSVGPFFY 225 >ref|XP_006295080.1| hypothetical protein CARUB_v10024151mg [Capsella rubella] gi|482563788|gb|EOA27978.1| hypothetical protein CARUB_v10024151mg [Capsella rubella] Length = 180 Score = 73.2 bits (178), Expect = 3e-11 Identities = 46/107 (42%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYSSPKY--------SFKNCKVFLD 252 RVTCE D++GYE +V + TD KGYFL L+ Y K C+ FL Sbjct: 62 RVTCERADEYGYEGEDVTVLSQATDAKGYFLATLSSSEVKDYFNSKNKVMRIKECRAFL- 120 Query: 251 EASHGDYCSVPTNTNNGISGATPAKPRRLSG--NYVLFSVGPFAFIP 117 E S D CS PT N GISGA K R + LF+VGPF F P Sbjct: 121 ELSPSDTCSFPTEINRGISGAILQKYRLVENKLKMKLFTVGPFVFSP 167 >ref|XP_003536042.1| PREDICTED: proline-rich protein 3-like [Glycine max] Length = 170 Score = 73.2 bits (178), Expect = 3e-11 Identities = 44/100 (44%), Positives = 57/100 (57%), Gaps = 2/100 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 R+ CE D++G+E+ PFS + TD KGYFL L+ K K C+ FLD AS + Sbjct: 64 RIACEAVDEYGFETTPFSFLSEATDSKGYFLATLSPQEVEGKGVLKECRAFLD-ASPLNN 122 Query: 230 CSVPTNTNNGISGATPAKPRRLSGNYV-LFSVGPFAFIPS 114 CS PT+ N GISGA R L + L++VGPF F S Sbjct: 123 CSYPTDVNKGISGAVLRFHRFLHDKKMKLYTVGPFQFTAS 162 >ref|NP_182276.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis thaliana] gi|2529673|gb|AAC62856.1| hypothetical protein [Arabidopsis thaliana] gi|330255762|gb|AEC10856.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis thaliana] Length = 173 Score = 72.8 bits (177), Expect = 5e-11 Identities = 45/101 (44%), Positives = 53/101 (52%), Gaps = 6/101 (5%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYSSPKY----SFKNCKVFLDEASH 240 RVTCE D++GYE+ +V + TD KGYFL L+ Y K C+ FL E S Sbjct: 60 RVTCERTDEYGYEAEDVTVLSQATDAKGYFLATLSSSEVKDYKKVIKIKECRAFL-ELSP 118 Query: 239 GDYCSVPTNTNNGISGATPAKPRRLSG--NYVLFSVGPFAF 123 D CS PT N GISGA R L LF+VGPF F Sbjct: 119 SDTCSFPTEINRGISGAILQNYRLLENKLKMKLFTVGPFVF 159 >ref|XP_003591486.1| hypothetical protein MTR_1g088110 [Medicago truncatula] gi|355480534|gb|AES61737.1| hypothetical protein MTR_1g088110 [Medicago truncatula] Length = 582 Score = 71.2 bits (173), Expect = 1e-10 Identities = 40/94 (42%), Positives = 55/94 (58%), Gaps = 1/94 (1%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 RVTCE ++ GYE+ P +V + TD KGY+ + L+ K CK +L E+S + Sbjct: 477 RVTCECVNELGYETGPITVLSHVTDSKGYYYVTLSLAELGSKLKINECKAYL-ESSPLET 535 Query: 230 CSVPTNTNNGISGATPAKPRRLSGNYVLFSVGPF 129 C VPT+ N+GISGA + R L N L+SV PF Sbjct: 536 CKVPTDVNHGISGAPLSSYRLLENNSRLYSVAPF 569 >ref|XP_004247533.1| PREDICTED: uncharacterized protein LOC101257107 [Solanum lycopersicum] Length = 205 Score = 70.1 bits (170), Expect = 3e-10 Identities = 42/103 (40%), Positives = 58/103 (56%), Gaps = 8/103 (7%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGY----FLINLAKYSSPKYSFKNCKVFLDEASH 240 R+TC +KHG+E+APFS + ++D KGY F +N K + CK FL E+S Sbjct: 80 RITCLGTEKHGHETAPFSFSSYQSDAKGYYYAVFSLNELKEYDQSCTITQCKAFL-ESSS 138 Query: 239 GDYCSVPTNTNNGISGATPAKPRRLS----GNYVLFSVGPFAF 123 + C VPT+ NNGI+GA R L+ VL+SV PF + Sbjct: 139 LEECDVPTDENNGITGAILTSYRLLNEYAEKKTVLYSVAPFVY 181 >ref|XP_004495936.1| PREDICTED: proline-rich protein 3-like [Cicer arietinum] Length = 185 Score = 69.7 bits (169), Expect = 4e-10 Identities = 42/97 (43%), Positives = 57/97 (58%), Gaps = 2/97 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 R+TCE D+ G+E+ FS + T++KGYFL L+ + K CK FLD AS + Sbjct: 79 RITCEAADEFGFETRAFSFLSDATNEKGYFLATLSPSEVTEKRVLNECKAFLD-ASPLNN 137 Query: 230 CSVPTNTNNGISGATPAKPRRLSGNYV-LFSVGPFAF 123 C+ PT+ N GISGA R L N + L++VGPF F Sbjct: 138 CNYPTDFNKGISGAELHSYRFLHDNNINLYTVGPFLF 174 >ref|XP_003591488.1| Pistil-specific extensin-like protein [Medicago truncatula] gi|355480536|gb|AES61739.1| Pistil-specific extensin-like protein [Medicago truncatula] Length = 180 Score = 69.7 bits (169), Expect = 4e-10 Identities = 42/98 (42%), Positives = 57/98 (58%), Gaps = 3/98 (3%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS--SPKYSFKNCKVFLDEASHGD 234 R+ CE D++G+E+ PFS T+ KGYFL L + + K K C+VFL EAS + Sbjct: 73 RIECEAADEYGFETKPFSFLNDATNAKGYFLATLFQQELVAEKRVLKECRVFL-EASPLN 131 Query: 233 YCSVPTNTNNGISGATPAKPRRLSGNYV-LFSVGPFAF 123 C+ PT+ N GISGA L N + L++VGPF F Sbjct: 132 NCNYPTDFNKGISGAELHSYHFLHDNKMNLYTVGPFVF 169 >ref|XP_002523123.1| structural constituent of cell wall, putative [Ricinus communis] gi|223537685|gb|EEF39308.1| structural constituent of cell wall, putative [Ricinus communis] Length = 486 Score = 69.7 bits (169), Expect = 4e-10 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 2/97 (2%) Frame = -3 Query: 407 RVTCEVKDKHGYESAPFSVDTPRTDKKGYFLINLAKYS-SPKYSFKNCKVFLDEASHGDY 231 R+TC V DK GY++ PFS T TD KGYF L+ +CKV L E S + Sbjct: 379 RITCSVLDKSGYKTTPFSCLTGATDAKGYFFKALSLLGLDDDLKLIDCKVNL-ERSPLET 437 Query: 230 CSVPTNTNNGISGATPAKPRRLSGNYV-LFSVGPFAF 123 CS+PT+ N GI+GA + R LS + LFSVGPF + Sbjct: 438 CSIPTDVNKGITGAHLSSYRILSDKKLKLFSVGPFFY 474