BLASTX nr result
ID: Achyranthes23_contig00045072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00045072 (355 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444485.1| hypothetical protein CICLE_v10023268mg [Citr... 56 4e-06 >ref|XP_006444485.1| hypothetical protein CICLE_v10023268mg [Citrus clementina] gi|557546747|gb|ESR57725.1| hypothetical protein CICLE_v10023268mg [Citrus clementina] Length = 1117 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 244 VRLMGGDIEIVDKADGKQGTCFKFNIFLTIEE 339 VRLMGGDIEIVDK +G++GTCF+FN+FL I E Sbjct: 590 VRLMGGDIEIVDKENGERGTCFRFNVFLAIRE 621