BLASTX nr result
ID: Achyranthes23_contig00044635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00044635 (363 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT13058.1| Mitochondrial inner membrane magnesium transporte... 55 7e-06 gb|EMS62342.1| Magnesium transporter MRS2-I [Triticum urartu] 55 7e-06 dbj|BAK06708.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 7e-06 >gb|EMT13058.1| Mitochondrial inner membrane magnesium transporter mrs2 [Aegilops tauschii] Length = 341 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 2 FKWVVIISGFFCTMLFLVIISYARHKGLVGS 94 FKWVVI+SG FC +F+ I++YARHKGLVGS Sbjct: 311 FKWVVIVSGLFCAFMFVTIVAYARHKGLVGS 341 >gb|EMS62342.1| Magnesium transporter MRS2-I [Triticum urartu] Length = 334 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 2 FKWVVIISGFFCTMLFLVIISYARHKGLVGS 94 FKWVVI+SG FC +F+ I++YARHKGLVGS Sbjct: 304 FKWVVIVSGLFCAFMFVTIVAYARHKGLVGS 334 >dbj|BAK06708.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 388 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 2 FKWVVIISGFFCTMLFLVIISYARHKGLVGS 94 FKWVVI+SG FC +F+ I++YARHKGLVGS Sbjct: 358 FKWVVIVSGLFCAFMFVTIVAYARHKGLVGS 388