BLASTX nr result
ID: Achyranthes23_contig00044249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00044249 (307 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK13848.1| suppressor of gene silencing 3 [Beta vulgaris sub... 58 1e-06 >gb|AFK13848.1| suppressor of gene silencing 3 [Beta vulgaris subsp. vulgaris] Length = 603 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = -3 Query: 305 MKKRHWHEEVELENDFDAAYTKLMDKFAPRPTE---SAAGNA 189 MKKRHW EE+ELE +FDA TKLM K+AP PTE +A+G+A Sbjct: 562 MKKRHWEEELELEKEFDATLTKLMQKYAPHPTEGLDAASGSA 603