BLASTX nr result
ID: Achyranthes23_contig00044066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00044066 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY02254.1| PR domain zinc finger protein 8, putative isoform... 63 5e-08 gb|EOY02253.1| PR domain zinc finger protein 8, putative isoform... 63 5e-08 >gb|EOY02254.1| PR domain zinc finger protein 8, putative isoform 2, partial [Theobroma cacao] gi|508710359|gb|EOY02256.1| PR domain zinc finger protein 8, putative isoform 2, partial [Theobroma cacao] Length = 200 Score = 62.8 bits (151), Expect = 5e-08 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 14/120 (11%) Frame = +3 Query: 9 SLELCAQANGDMISHLEDRGIPPTSAGVEGNTKGSALCLIMHIPNGE-------CLGP-- 161 S +L +++ I I P+++ EGN + S L I N E C P Sbjct: 14 SPKLIKKSDNICIEEANREVIDPSTSSREGNEETS-LGPITPDANREIGEFPYNCNSPPT 72 Query: 162 ---EPQNMGCFQSES--NEEAAASPMDCSPRTPETGVFDPFAAGPDEMLLAPICKKLMKE 326 +PQ + F ++ N+++ AS CSP+TP+ GVFDPFA GP++M+LAP+C+K + E Sbjct: 73 AVKKPQKIPHFDPDATTNQDSLASANHCSPKTPKDGVFDPFAPGPEDMVLAPLCRKYIDE 132 >gb|EOY02253.1| PR domain zinc finger protein 8, putative isoform 1 [Theobroma cacao] gi|508710358|gb|EOY02255.1| PR domain zinc finger protein 8, putative isoform 1 [Theobroma cacao] gi|508710360|gb|EOY02257.1| PR domain zinc finger protein 8, putative isoform 1 [Theobroma cacao] Length = 241 Score = 62.8 bits (151), Expect = 5e-08 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 14/120 (11%) Frame = +3 Query: 9 SLELCAQANGDMISHLEDRGIPPTSAGVEGNTKGSALCLIMHIPNGE-------CLGP-- 161 S +L +++ I I P+++ EGN + S L I N E C P Sbjct: 14 SPKLIKKSDNICIEEANREVIDPSTSSREGNEETS-LGPITPDANREIGEFPYNCNSPPT 72 Query: 162 ---EPQNMGCFQSES--NEEAAASPMDCSPRTPETGVFDPFAAGPDEMLLAPICKKLMKE 326 +PQ + F ++ N+++ AS CSP+TP+ GVFDPFA GP++M+LAP+C+K + E Sbjct: 73 AVKKPQKIPHFDPDATTNQDSLASANHCSPKTPKDGVFDPFAPGPEDMVLAPLCRKYIDE 132