BLASTX nr result
ID: Achyranthes23_contig00044056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00044056 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24139.1| CLIP-associating protein 1-B [Morus notabilis] 69 5e-10 gb|ESW34641.1| hypothetical protein PHAVU_001G168400g [Phaseolus... 69 6e-10 ref|XP_003554315.1| PREDICTED: CLIP-associated protein-like [Gly... 69 6e-10 ref|XP_006443676.1| hypothetical protein CICLE_v10018498mg [Citr... 68 1e-09 gb|EMJ02149.1| hypothetical protein PRUPE_ppa000220mg [Prunus pe... 68 1e-09 ref|XP_003521327.1| PREDICTED: CLIP-associated protein-like [Gly... 68 1e-09 ref|XP_004493856.1| PREDICTED: CLIP-associated protein-like isof... 67 2e-09 ref|XP_004493855.1| PREDICTED: CLIP-associated protein-like isof... 67 2e-09 ref|XP_006350293.1| PREDICTED: CLIP-associated protein-like [Sol... 67 3e-09 gb|EPS65715.1| hypothetical protein M569_09065, partial [Genlise... 67 3e-09 ref|XP_004290027.1| PREDICTED: CLIP-associating protein 1-like [... 67 3e-09 ref|XP_004247112.1| PREDICTED: CLIP-associating protein 1-B-like... 67 3e-09 ref|XP_004247111.1| PREDICTED: CLIP-associating protein 1-B-like... 67 3e-09 emb|CBI37240.3| unnamed protein product [Vitis vinifera] 66 5e-09 ref|XP_002265367.1| PREDICTED: CLIP-associating protein-like [Vi... 66 5e-09 ref|XP_002303094.1| CLIP-associating family protein [Populus tri... 66 5e-09 gb|EOX94113.1| CLIP-associated protein isoform 5 [Theobroma cacao] 64 2e-08 gb|EOX94112.1| CLIP-associated protein isoform 4 [Theobroma cacao] 64 2e-08 gb|EOX94111.1| CLIP-associated protein isoform 3 [Theobroma cacao] 64 2e-08 gb|EOX94109.1| CLIP-associated protein isoform 1 [Theobroma cacao] 64 2e-08 >gb|EXC24139.1| CLIP-associating protein 1-B [Morus notabilis] Length = 1471 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLHQLLE+SRK LTSSE Sbjct: 1 MEEALELARAKDTKERMAGVERLHQLLEASRKSLTSSE 38 >gb|ESW34641.1| hypothetical protein PHAVU_001G168400g [Phaseolus vulgaris] Length = 1445 Score = 68.9 bits (167), Expect = 6e-10 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALELSRAKDTKERMAGVERLHQLLE+SRK L+SSE Sbjct: 1 MEEALELSRAKDTKERMAGVERLHQLLEASRKSLSSSE 38 >ref|XP_003554315.1| PREDICTED: CLIP-associated protein-like [Glycine max] Length = 1444 Score = 68.9 bits (167), Expect = 6e-10 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALELSRAKDTKERMAGVERLHQLLE+SRK L+SSE Sbjct: 1 MEEALELSRAKDTKERMAGVERLHQLLEASRKSLSSSE 38 >ref|XP_006443676.1| hypothetical protein CICLE_v10018498mg [Citrus clementina] gi|568853044|ref|XP_006480177.1| PREDICTED: CLIP-associated protein-like [Citrus sinensis] gi|557545938|gb|ESR56916.1| hypothetical protein CICLE_v10018498mg [Citrus clementina] Length = 1418 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLHQLLE+SRK LTS+E Sbjct: 1 MEEALELARAKDTKERMAGVERLHQLLEASRKSLTSAE 38 >gb|EMJ02149.1| hypothetical protein PRUPE_ppa000220mg [Prunus persica] Length = 1444 Score = 67.8 bits (164), Expect = 1e-09 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLHQLLE+SRK L+SSE Sbjct: 1 MEEALELARAKDTKERMAGVERLHQLLEASRKSLSSSE 38 >ref|XP_003521327.1| PREDICTED: CLIP-associated protein-like [Glycine max] Length = 1440 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALELSRAKDTKERMAGVERLHQLLE SRK L+SSE Sbjct: 1 MEEALELSRAKDTKERMAGVERLHQLLEVSRKSLSSSE 38 >ref|XP_004493856.1| PREDICTED: CLIP-associated protein-like isoform X2 [Cicer arietinum] Length = 1445 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERL+QLLE+SRK LTSSE Sbjct: 1 MEEALELARAKDTKERMAGVERLYQLLEASRKSLTSSE 38 >ref|XP_004493855.1| PREDICTED: CLIP-associated protein-like isoform X1 [Cicer arietinum] Length = 1452 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERL+QLLE+SRK LTSSE Sbjct: 1 MEEALELARAKDTKERMAGVERLYQLLEASRKSLTSSE 38 >ref|XP_006350293.1| PREDICTED: CLIP-associated protein-like [Solanum tuberosum] Length = 1429 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLH+LLE+SRK L+SSE Sbjct: 1 MEEALELARAKDTKERMAGVERLHELLEASRKSLSSSE 38 >gb|EPS65715.1| hypothetical protein M569_09065, partial [Genlisea aurea] Length = 164 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEAL+L+RAKDTKERMAGVERLHQLLESSRK L++SE Sbjct: 1 MEEALDLARAKDTKERMAGVERLHQLLESSRKALSTSE 38 >ref|XP_004290027.1| PREDICTED: CLIP-associating protein 1-like [Fragaria vesca subsp. vesca] Length = 1439 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLHQLLE+SRK L+S+E Sbjct: 1 MEEALELARAKDTKERMAGVERLHQLLEASRKSLSSAE 38 >ref|XP_004247112.1| PREDICTED: CLIP-associating protein 1-B-like isoform 2 [Solanum lycopersicum] Length = 1388 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLH+LLE+SRK L+SSE Sbjct: 1 MEEALELARAKDTKERMAGVERLHELLEASRKSLSSSE 38 >ref|XP_004247111.1| PREDICTED: CLIP-associating protein 1-B-like isoform 1 [Solanum lycopersicum] Length = 1426 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLH+LLE+SRK L+SSE Sbjct: 1 MEEALELARAKDTKERMAGVERLHELLEASRKSLSSSE 38 >emb|CBI37240.3| unnamed protein product [Vitis vinifera] Length = 200 Score = 65.9 bits (159), Expect = 5e-09 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLH LLESSRK L+S+E Sbjct: 1 MEEALELARAKDTKERMAGVERLHHLLESSRKALSSAE 38 >ref|XP_002265367.1| PREDICTED: CLIP-associating protein-like [Vitis vinifera] Length = 1440 Score = 65.9 bits (159), Expect = 5e-09 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLH LLESSRK L+S+E Sbjct: 1 MEEALELARAKDTKERMAGVERLHHLLESSRKALSSAE 38 >ref|XP_002303094.1| CLIP-associating family protein [Populus trichocarpa] gi|222844820|gb|EEE82367.1| CLIP-associating family protein [Populus trichocarpa] Length = 1426 Score = 65.9 bits (159), Expect = 5e-09 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMAGVERLHQLLE+ RK L+SSE Sbjct: 1 MEEALELARAKDTKERMAGVERLHQLLEACRKSLSSSE 38 >gb|EOX94113.1| CLIP-associated protein isoform 5 [Theobroma cacao] Length = 1258 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMA VERL+QLLE SRK LTSSE Sbjct: 1 MEEALELARAKDTKERMAAVERLYQLLEGSRKSLTSSE 38 >gb|EOX94112.1| CLIP-associated protein isoform 4 [Theobroma cacao] Length = 1289 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMA VERL+QLLE SRK LTSSE Sbjct: 1 MEEALELARAKDTKERMAAVERLYQLLEGSRKSLTSSE 38 >gb|EOX94111.1| CLIP-associated protein isoform 3 [Theobroma cacao] Length = 1353 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMA VERL+QLLE SRK LTSSE Sbjct: 1 MEEALELARAKDTKERMAAVERLYQLLEGSRKSLTSSE 38 >gb|EOX94109.1| CLIP-associated protein isoform 1 [Theobroma cacao] Length = 1442 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 116 MEEALELSRAKDTKERMAGVERLHQLLESSRKPLTSSE 3 MEEALEL+RAKDTKERMA VERL+QLLE SRK LTSSE Sbjct: 1 MEEALELARAKDTKERMAAVERLYQLLEGSRKSLTSSE 38