BLASTX nr result
ID: Achyranthes23_contig00043961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00043961 (483 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006587597.1| PREDICTED: UDP-N-acetylglucosamine transfera... 55 7e-06 >ref|XP_006587597.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog, partial [Glycine max] Length = 232 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -3 Query: 481 SIARVXXXXXXXXXXXXXRMADQLYVQWPQLQRKYPRSVYVGRLM 347 SIARV RMADQL+VQWPQLQR+YPR+ YVGRLM Sbjct: 188 SIARVRRLSLSGLLLYKLRMADQLFVQWPQLQRQYPRATYVGRLM 232