BLASTX nr result
ID: Achyranthes23_contig00043929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00043929 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310152.2| hypothetical protein POPTR_0007s11210g [Popu... 64 3e-08 ref|XP_002307259.2| nodulation family protein [Populus trichocar... 63 4e-08 ref|XP_006600992.1| PREDICTED: uncharacterized protein LOC100778... 62 6e-08 ref|XP_006600991.1| PREDICTED: uncharacterized protein LOC100778... 62 6e-08 ref|XP_003551040.1| PREDICTED: uncharacterized protein LOC100778... 62 6e-08 ref|XP_003611774.1| hypothetical protein MTR_5g017700 [Medicago ... 62 8e-08 ref|XP_006579880.1| PREDICTED: uncharacterized protein LOC100795... 62 1e-07 ref|XP_006579879.1| PREDICTED: uncharacterized protein LOC100795... 62 1e-07 ref|XP_004509154.1| PREDICTED: nodulation protein H-like [Cicer ... 62 1e-07 ref|XP_006362384.1| PREDICTED: uncharacterized protein LOC102583... 61 1e-07 gb|EMJ02428.1| hypothetical protein PRUPE_ppa008107mg [Prunus pe... 61 1e-07 ref|XP_006409530.1| hypothetical protein EUTSA_v10022768mg [Eutr... 60 2e-07 ref|NP_179175.3| P-loop containing nucleoside triphosphate hydro... 60 2e-07 gb|AAD17417.1| hypothetical protein [Arabidopsis thaliana] 60 2e-07 gb|EXC17368.1| Nodulation protein H [Morus notabilis] 60 3e-07 ref|XP_004511944.1| PREDICTED: uncharacterized protein LOC101497... 60 3e-07 ref|XP_004511943.1| PREDICTED: uncharacterized protein LOC101497... 60 3e-07 ref|XP_004294841.1| PREDICTED: uncharacterized protein LOC101305... 60 3e-07 ref|XP_002522303.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 ref|XP_006434820.1| hypothetical protein CICLE_v10003614mg [Citr... 60 4e-07 >ref|XP_002310152.2| hypothetical protein POPTR_0007s11210g [Populus trichocarpa] gi|550334640|gb|EEE90602.2| hypothetical protein POPTR_0007s11210g [Populus trichocarpa] Length = 342 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIHKGPLS+HV NW DI +TL+GT +ESFL +DY Sbjct: 306 RQVKIHKGPLSDHVKNWEDINKTLNGTAYESFLQADY 342 >ref|XP_002307259.2| nodulation family protein [Populus trichocarpa] gi|550339210|gb|EEE94255.2| nodulation family protein [Populus trichocarpa] Length = 342 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIHKGPLS+HV NW D+ +TL+GT +ESFL +DY Sbjct: 306 RQVKIHKGPLSDHVKNWEDVNKTLNGTAYESFLQADY 342 >ref|XP_006600992.1| PREDICTED: uncharacterized protein LOC100778075 isoform X3 [Glycine max] Length = 302 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIH+GPLS+H+ NW D+ RTL GT +ESFL++DY Sbjct: 264 RQVKIHRGPLSDHIKNWDDVNRTLTGTVYESFLHADY 300 >ref|XP_006600991.1| PREDICTED: uncharacterized protein LOC100778075 isoform X2 [Glycine max] Length = 354 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIH+GPLS+H+ NW D+ RTL GT +ESFL++DY Sbjct: 316 RQVKIHRGPLSDHIKNWDDVNRTLTGTVYESFLHADY 352 >ref|XP_003551040.1| PREDICTED: uncharacterized protein LOC100778075 isoform X1 [Glycine max] Length = 350 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIH+GPLS+H+ NW D+ RTL GT +ESFL++DY Sbjct: 312 RQVKIHRGPLSDHIKNWDDVNRTLTGTVYESFLHADY 348 >ref|XP_003611774.1| hypothetical protein MTR_5g017700 [Medicago truncatula] gi|355513109|gb|AES94732.1| hypothetical protein MTR_5g017700 [Medicago truncatula] Length = 342 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIHKGPLS+H+ NW D+ +TL GT +ESFL +DY Sbjct: 306 RQVKIHKGPLSDHIQNWDDVNKTLTGTVYESFLEADY 342 >ref|XP_006579880.1| PREDICTED: uncharacterized protein LOC100795357 isoform X2 [Glycine max] Length = 402 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIH+GPLS+H+ NW D+ RTL GT +ESFL++DY Sbjct: 364 RQVKIHRGPLSDHIKNWDDVNRTLAGTIYESFLHADY 400 >ref|XP_006579879.1| PREDICTED: uncharacterized protein LOC100795357 isoform X1 [Glycine max] Length = 423 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIH+GPLS+H+ NW D+ RTL GT +ESFL++DY Sbjct: 385 RQVKIHRGPLSDHIKNWDDVNRTLAGTIYESFLHADY 421 >ref|XP_004509154.1| PREDICTED: nodulation protein H-like [Cicer arietinum] Length = 344 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIHKGPLSEH+ NW ++ +TL GT +ESFL +DY Sbjct: 306 RQVKIHKGPLSEHINNWNEVAKTLKGTTYESFLQADY 342 >ref|XP_006362384.1| PREDICTED: uncharacterized protein LOC102583031 [Solanum tuberosum] Length = 342 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIH GPL EH+ NW D+ +TL GT +ESFL SDY Sbjct: 306 RQVKIHSGPLQEHIKNWDDVNKTLKGTAYESFLRSDY 342 >gb|EMJ02428.1| hypothetical protein PRUPE_ppa008107mg [Prunus persica] Length = 345 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDYR 164 RQVKIHKG LS + NWGD+++TL GT++E+FL++DYR Sbjct: 306 RQVKIHKGTLSNQIENWGDVEKTLTGTQYENFLHADYR 343 >ref|XP_006409530.1| hypothetical protein EUTSA_v10022768mg [Eutrema salsugineum] gi|557110692|gb|ESQ50983.1| hypothetical protein EUTSA_v10022768mg [Eutrema salsugineum] Length = 344 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDYR 164 RQVKIH GPLS+HV NW ++Q+TL GT FE+FL DYR Sbjct: 306 RQVKIHHGPLSQHVQNWEEVQKTLKGTGFENFLLEDYR 343 >ref|NP_179175.3| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Arabidopsis thaliana] gi|40823013|gb|AAR92253.1| At2g15730 [Arabidopsis thaliana] gi|45752690|gb|AAS76243.1| At2g15730 [Arabidopsis thaliana] gi|330251339|gb|AEC06433.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Arabidopsis thaliana] Length = 344 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDYR 164 RQVKIH GPLS+HV NW ++Q+TL GT FE+FL DYR Sbjct: 306 RQVKIHHGPLSQHVQNWEEVQKTLKGTGFENFLLEDYR 343 >gb|AAD17417.1| hypothetical protein [Arabidopsis thaliana] Length = 213 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDYR 164 RQVKIH GPLS+HV NW ++Q+TL GT FE+FL DYR Sbjct: 175 RQVKIHHGPLSQHVQNWEEVQKTLKGTGFENFLLEDYR 212 >gb|EXC17368.1| Nodulation protein H [Morus notabilis] Length = 344 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDYR 164 RQVKIHKG LS V NW D+Q+TL GT +ESFL+SDYR Sbjct: 300 RQVKIHKGSLSNLVENWDDVQKTLTGTPYESFLHSDYR 337 >ref|XP_004511944.1| PREDICTED: uncharacterized protein LOC101497581 isoform X2 [Cicer arietinum] Length = 342 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIHKGPLS+H+ NW D+ + L GT +ESFL +DY Sbjct: 306 RQVKIHKGPLSDHIQNWDDVNKVLTGTVYESFLEADY 342 >ref|XP_004511943.1| PREDICTED: uncharacterized protein LOC101497581 isoform X1 [Cicer arietinum] Length = 343 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIHKGPLS+H+ NW D+ + L GT +ESFL +DY Sbjct: 307 RQVKIHKGPLSDHIQNWDDVNKVLTGTVYESFLEADY 343 >ref|XP_004294841.1| PREDICTED: uncharacterized protein LOC101305349 [Fragaria vesca subsp. vesca] Length = 341 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDYR 164 RQVKIHKG LS V NWGD+Q+ L+GT +ESFL+SD R Sbjct: 303 RQVKIHKGSLSNQVENWGDVQKALNGTHYESFLHSDLR 340 >ref|XP_002522303.1| conserved hypothetical protein [Ricinus communis] gi|223538381|gb|EEF39987.1| conserved hypothetical protein [Ricinus communis] Length = 329 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDY 167 RQVKIHKGPLS+H+ NW D+ + L GT +ESFL +DY Sbjct: 293 RQVKIHKGPLSDHIKNWEDVNKALTGTAYESFLEADY 329 >ref|XP_006434820.1| hypothetical protein CICLE_v10003614mg [Citrus clementina] gi|557536942|gb|ESR48060.1| hypothetical protein CICLE_v10003614mg [Citrus clementina] Length = 302 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 277 RQVKIHKGPLSEHVANWGDIQRTLDGTEFESFLNSDYRL 161 RQVKIH GPLS+ V NW D+Q+ L GT +E FL+SDYR+ Sbjct: 264 RQVKIHSGPLSKQVENWDDVQKALKGTSYERFLHSDYRV 302