BLASTX nr result
ID: Achyranthes23_contig00043703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00043703 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60774.1| hypothetical protein M569_14027, partial [Genlise... 58 1e-06 >gb|EPS60774.1| hypothetical protein M569_14027, partial [Genlisea aurea] Length = 55 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 IQRIPVLGWLLQHPLIRSFIDRFRGKRVPV 91 +Q+IPV+GWL QHPL RSF DRFRGKRVPV Sbjct: 26 LQKIPVVGWLFQHPLFRSFFDRFRGKRVPV 55