BLASTX nr result
ID: Achyranthes23_contig00043637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00043637 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326892.1| predicted protein [Populus trichocarpa] gi|5... 76 4e-12 gb|EOY14694.1| Peroxin 11A isoform 2, partial [Theobroma cacao] 74 2e-11 gb|EOY14693.1| Peroxin 11A isoform 1 [Theobroma cacao] 74 2e-11 gb|EXC07297.1| Peroxisomal membrane protein 11A [Morus notabilis] 73 4e-11 ref|XP_006367303.1| PREDICTED: peroxisomal membrane protein 11A-... 71 1e-10 ref|XP_004238230.1| PREDICTED: peroxisomal membrane protein 11A-... 71 1e-10 ref|XP_004291898.1| PREDICTED: peroxisomal membrane protein 11A-... 70 4e-10 gb|EPS72971.1| hypothetical protein M569_01784, partial [Genlise... 69 5e-10 ref|XP_004160026.1| PREDICTED: peroxisomal membrane protein 11A-... 69 6e-10 ref|XP_004152708.1| PREDICTED: peroxisomal membrane protein 11A-... 69 6e-10 ref|XP_002510349.1| peroxisomal biogenesis factor, putative [Ric... 69 6e-10 ref|XP_002281733.1| PREDICTED: peroxisomal membrane protein 11A ... 69 8e-10 ref|XP_006473464.1| PREDICTED: peroxisomal membrane protein 11A-... 68 1e-09 ref|XP_006434939.1| hypothetical protein CICLE_v10002211mg [Citr... 68 1e-09 gb|EMJ27218.1| hypothetical protein PRUPE_ppa010125mg [Prunus pe... 68 1e-09 ref|XP_006854415.1| hypothetical protein AMTR_s00039p00202880 [A... 67 2e-09 ref|XP_002281759.1| PREDICTED: peroxisomal membrane protein 11A ... 67 3e-09 ref|XP_006393523.1| hypothetical protein EUTSA_v10011736mg [Eutr... 65 9e-09 ref|NP_564514.1| peroxisomal membrane protein 11A [Arabidopsis t... 65 9e-09 gb|AAM60843.1| unknown [Arabidopsis thaliana] gi|56368451|emb|CA... 65 9e-09 >ref|XP_002326892.1| predicted protein [Populus trichocarpa] gi|566202405|ref|XP_006375076.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|550323390|gb|ERP52873.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] Length = 255 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QDF+D LMALADIRDG+G+ P ++SCAGLLSALISTHKNWV+C Sbjct: 211 QDFADGLMALADIRDGRGQFSGPLLVSCAGLLSALISTHKNWVSC 255 >gb|EOY14694.1| Peroxin 11A isoform 2, partial [Theobroma cacao] Length = 228 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LMALADI+DG+G+ P V+SCAGLLSALISTHKNWV+C Sbjct: 184 QDLADGLMALADIQDGKGRFSDPLVVSCAGLLSALISTHKNWVSC 228 >gb|EOY14693.1| Peroxin 11A isoform 1 [Theobroma cacao] Length = 251 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LMALADI+DG+G+ P V+SCAGLLSALISTHKNWV+C Sbjct: 207 QDLADGLMALADIQDGKGRFSDPLVVSCAGLLSALISTHKNWVSC 251 >gb|EXC07297.1| Peroxisomal membrane protein 11A [Morus notabilis] Length = 264 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LMALADIRDG+G + P +SCAGLLSALISTHKNW++C Sbjct: 220 QDLADGLMALADIRDGKGLLLGPLSVSCAGLLSALISTHKNWISC 264 >ref|XP_006367303.1| PREDICTED: peroxisomal membrane protein 11A-like [Solanum tuberosum] Length = 258 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QDF+D LMALADI DG+G + +P +LS AGLLSALISTHKNW++C Sbjct: 214 QDFADGLMALADISDGKGMLSAPLLLSSAGLLSALISTHKNWISC 258 >ref|XP_004238230.1| PREDICTED: peroxisomal membrane protein 11A-like [Solanum lycopersicum] Length = 256 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QDF+D LMALADI DG+G + +P +LS AGLLSALISTHKNW++C Sbjct: 212 QDFADGLMALADISDGKGMLSAPLLLSSAGLLSALISTHKNWISC 256 >ref|XP_004291898.1| PREDICTED: peroxisomal membrane protein 11A-like [Fragaria vesca subsp. vesca] Length = 260 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +DALMALADIRDG+G P +S AGLLSALISTHKNWV+C Sbjct: 216 QDSADALMALADIRDGKGHFLGPLSVSIAGLLSALISTHKNWVSC 260 >gb|EPS72971.1| hypothetical protein M569_01784, partial [Genlisea aurea] Length = 264 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVT 138 QDF+D LMALADIRDG+G++ +P ++S AGLLSA+ISTHKNWV+ Sbjct: 220 QDFADGLMALADIRDGRGRLSAPVIVSFAGLLSAVISTHKNWVS 263 >ref|XP_004160026.1| PREDICTED: peroxisomal membrane protein 11A-like [Cucumis sativus] Length = 247 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QDF+D MA+AD+RDG G+ P ++S AGLLSALISTHKNW++C Sbjct: 203 QDFADGFMAVADVRDGNGRFSGPLLISFAGLLSALISTHKNWISC 247 >ref|XP_004152708.1| PREDICTED: peroxisomal membrane protein 11A-like [Cucumis sativus] Length = 247 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QDF+D MA+AD+RDG G+ P ++S AGLLSALISTHKNW++C Sbjct: 203 QDFADGFMAVADVRDGNGRFSGPLLISFAGLLSALISTHKNWISC 247 >ref|XP_002510349.1| peroxisomal biogenesis factor, putative [Ricinus communis] gi|223551050|gb|EEF52536.1| peroxisomal biogenesis factor, putative [Ricinus communis] Length = 261 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QDF+D LMALADIRDG+G++ P +S AGLLSALIST KNWV+C Sbjct: 217 QDFADGLMALADIRDGKGRLSGPLWVSVAGLLSALISTRKNWVSC 261 >ref|XP_002281733.1| PREDICTED: peroxisomal membrane protein 11A [Vitis vinifera] Length = 260 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LMALADIRDG+G++ P ++S AGLLSALIS HKNW++C Sbjct: 216 QDLADGLMALADIRDGKGRLSGPLLMSSAGLLSALISAHKNWLSC 260 >ref|XP_006473464.1| PREDICTED: peroxisomal membrane protein 11A-like [Citrus sinensis] Length = 259 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LMALADIRDG+G +F P ++ AGLLSA+ISTHKNW++C Sbjct: 215 QDLADGLMALADIRDGKGMLFGPLWVASAGLLSAVISTHKNWLSC 259 >ref|XP_006434939.1| hypothetical protein CICLE_v10002211mg [Citrus clementina] gi|557537061|gb|ESR48179.1| hypothetical protein CICLE_v10002211mg [Citrus clementina] Length = 259 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LMALADIRDG+G +F P ++ AGLLSA+ISTHKNW++C Sbjct: 215 QDLADGLMALADIRDGKGMLFGPLWVASAGLLSAVISTHKNWLSC 259 >gb|EMJ27218.1| hypothetical protein PRUPE_ppa010125mg [Prunus persica] Length = 262 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +DALMALADIRDG G P +S AG+LSALISTHKNWV C Sbjct: 218 QDAADALMALADIRDGDGPFLGPLSISLAGMLSALISTHKNWVYC 262 >ref|XP_006854415.1| hypothetical protein AMTR_s00039p00202880 [Amborella trichopoda] gi|548858091|gb|ERN15882.1| hypothetical protein AMTR_s00039p00202880 [Amborella trichopoda] Length = 240 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QDF+DALMAL DI+DG+G + P ++ AGLLSA+ISTHKNWV+C Sbjct: 196 QDFADALMALGDIKDGRGFLAKPVFVAFAGLLSAIISTHKNWVSC 240 >ref|XP_002281759.1| PREDICTED: peroxisomal membrane protein 11A [Vitis vinifera] gi|302142451|emb|CBI19654.3| unnamed protein product [Vitis vinifera] Length = 260 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LMALADIRDG+G++ P ++S AGLLSAL S HKNW++C Sbjct: 216 QDLADGLMALADIRDGKGRLSGPLLMSSAGLLSALTSAHKNWLSC 260 >ref|XP_006393523.1| hypothetical protein EUTSA_v10011736mg [Eutrema salsugineum] gi|557090101|gb|ESQ30809.1| hypothetical protein EUTSA_v10011736mg [Eutrema salsugineum] Length = 249 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LM +AD+RDG+G + +P V+S AGL SA+ISTHKNWV+C Sbjct: 205 QDLADGLMTIADLRDGKGVLSAPNVISSAGLFSAIISTHKNWVSC 249 >ref|NP_564514.1| peroxisomal membrane protein 11A [Arabidopsis thaliana] gi|75173415|sp|Q9FZF1.1|PX11A_ARATH RecName: Full=Peroxisomal membrane protein 11A; AltName: Full=Peroxin-11A; Short=AtPEX11a gi|9802590|gb|AAF99792.1|AC012463_9 T2E6.18 [Arabidopsis thaliana] gi|87116582|gb|ABD19655.1| At1g47750 [Arabidopsis thaliana] gi|110742371|dbj|BAE99108.1| hypothetical protein [Arabidopsis thaliana] gi|332194087|gb|AEE32208.1| peroxisomal membrane protein 11A [Arabidopsis thaliana] Length = 248 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LM +ADIRDG+G + +P V+S AGL SA++STHKNW++C Sbjct: 204 QDLADGLMTIADIRDGKGVLSAPNVISSAGLFSAIVSTHKNWISC 248 >gb|AAM60843.1| unknown [Arabidopsis thaliana] gi|56368451|emb|CAD58677.1| putative PEX11-3 protein [Arabidopsis thaliana] Length = 248 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -1 Query: 269 QDFSDALMALADIRDGQGKVFSPFVLSCAGLLSALISTHKNWVTC 135 QD +D LM +ADIRDG+G + +P V+S AGL SA++STHKNW++C Sbjct: 204 QDLADGLMTIADIRDGKGVLSAPNVISSAGLFSAIVSTHKNWISC 248