BLASTX nr result
ID: Achyranthes23_contig00043258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00043258 (429 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289430.1| PREDICTED: uncharacterized protein LOC101297... 55 1e-05 >ref|XP_004289430.1| PREDICTED: uncharacterized protein LOC101297884 [Fragaria vesca subsp. vesca] Length = 646 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/59 (49%), Positives = 33/59 (55%), Gaps = 8/59 (13%) Frame = +1 Query: 277 SVDEEFIDVPDNFSPPPVVTPAF--------VSSGCPLNDHLRKMGLYVKREWLDSCKL 429 S DEEFIDV DN SPP P S GCP+ L+ +GL +KREWLD C L Sbjct: 48 SDDEEFIDVSDNLSPPSPEFPESHNPRPPPPSSGGCPIGQFLQGLGLRLKREWLDGCAL 106