BLASTX nr result
ID: Achyranthes23_contig00043236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00043236 (254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004327703.1| ribosomal protein L2 [Hevea brasiliensis] gi... 115 6e-24 gb|ADD30221.1| ribosomal protein L2 [Aucuba japonica] gi|3408071... 115 6e-24 gb|AHJ61444.1| ribosomal protein L2 [Cucumis hystrix] 115 8e-24 gb|AHH92803.1| ribosomal protein L2 (chloroplast) [Chenopodium q... 115 8e-24 gb|AHH92798.1| ribosomal protein L2 (chloroplast) [Chenopodium a... 115 8e-24 gb|AHH92796.1| ribosomal protein L2 (chloroplast) [Chenopodium q... 115 8e-24 gb|AHH92794.1| ribosomal protein L2 (chloroplast) [Chenopodium q... 115 8e-24 ref|NP_054540.1| ribosomal protein L2 [Nicotiana tabacum] gi|114... 115 8e-24 sp|P21434.1|RK2_NICDE RecName: Full=50S ribosomal protein L2, ch... 115 8e-24 ref|YP_009002296.1| ribosomal protein L2 (chloroplast) [Pinguicu... 115 8e-24 emb|CCQ71687.1| ribosomal protein L2 (chloroplast) [Salvia milti... 115 8e-24 ref|YP_009000055.1| ribosomal protein L2 (chloroplast) [Silene c... 115 8e-24 ref|YP_008992305.1| ribosomal protein L2 (mitochondrion) [Salvia... 115 8e-24 ref|YP_008994331.1| ribosomal protein L2 [Melianthus villosus] g... 115 8e-24 ref|YP_008965533.1| ribosomal protein L2 [Pyrus spinosa] gi|5656... 115 8e-24 ref|YP_008963641.1| ribosomal protein L2 (chloroplast) [Lupinus ... 115 8e-24 ref|YP_008964096.1| ribosomal protein L2 [Ajuga reptans] gi|5682... 115 8e-24 ref|YP_008814985.1| ribosomal protein L2 (chloroplast) [Brassaio... 115 8e-24 ref|YP_008816000.1| ribosomal protein L2 (chloroplast) [Lindenbe... 115 8e-24 gb|EPS74502.1| hypothetical protein M569_00219 [Genlisea aurea] 115 8e-24 >ref|YP_004327703.1| ribosomal protein L2 [Hevea brasiliensis] gi|326909455|ref|YP_004327724.1| ribosomal protein L2 [Hevea brasiliensis] gi|308523567|gb|ADO33617.1| ribosomal protein L2 [Hevea brasiliensis] gi|308523569|gb|ADO33619.1| ribosomal protein L2 [Hevea brasiliensis] Length = 277 Score = 115 bits (288), Expect = 6e-24 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV Sbjct: 65 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 117 >gb|ADD30221.1| ribosomal protein L2 [Aucuba japonica] gi|340807106|gb|AEK71707.1| ribosomal protein L2 [Aucuba japonica] Length = 274 Score = 115 bits (288), Expect = 6e-24 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 114 >gb|AHJ61444.1| ribosomal protein L2 [Cucumis hystrix] Length = 275 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >gb|AHH92803.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >gb|AHH92798.1| ribosomal protein L2 (chloroplast) [Chenopodium album] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >gb|AHH92796.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >gb|AHH92794.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] gi|578002903|gb|AHH92795.1| ribosomal protein L2 (chloroplast) [Chenopodium album] gi|578002911|gb|AHH92797.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] gi|578002916|gb|AHH92799.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] gi|578002918|gb|AHH92800.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] gi|578002921|gb|AHH92801.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] gi|578002923|gb|AHH92802.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] gi|578002927|gb|AHH92804.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] gi|578002929|gb|AHH92805.1| ribosomal protein L2 (chloroplast) [Chenopodium quinoa] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|NP_054540.1| ribosomal protein L2 [Nicotiana tabacum] gi|11466035|ref|NP_054577.1| ribosomal protein L2 [Nicotiana tabacum] gi|78102580|ref|YP_358720.1| ribosomal protein L2 [Nicotiana sylvestris] gi|78102619|ref|YP_358758.1| ribosomal protein L2 [Nicotiana sylvestris] gi|81301610|ref|YP_398906.1| ribosomal protein L2 [Nicotiana tomentosiformis] gi|81301649|ref|YP_398944.1| ribosomal protein L2 [Nicotiana tomentosiformis] gi|351653926|ref|YP_004891649.1| rpl2 gene product (chloroplast) [Nicotiana undulata] gi|351653963|ref|YP_004891687.1| rpl2 gene product (chloroplast) [Nicotiana undulata] gi|132866|sp|P06379.1|RK2_TOBAC RecName: Full=50S ribosomal protein L2, chloroplastic gi|116257508|sp|Q3C1N6.1|RK2_NICSY RecName: Full=50S ribosomal protein L2, chloroplastic gi|116257509|sp|Q33BZ0.1|RK2_NICTO RecName: Full=50S ribosomal protein L2, chloroplastic gi|435269|emb|CAA77384.1| ribosomal protein L2 [Nicotiana tabacum] gi|1223691|emb|CAA77409.1| ribosomal protein L2 [Nicotiana tabacum] gi|77799607|dbj|BAE46696.1| ribosomal protein L2 [Nicotiana sylvestris] gi|77799646|dbj|BAE46735.1| ribosomal protein L2 [Nicotiana sylvestris] gi|80750969|dbj|BAE48045.1| ribosomal protein L2 [Nicotiana tomentosiformis] gi|80751008|dbj|BAE48084.1| ribosomal protein L2 [Nicotiana tomentosiformis] gi|347453952|gb|AEO95610.1| ribosomal protein L2 (chloroplast) [Nicotiana undulata] gi|347453989|gb|AEO95647.1| ribosomal protein L2 (chloroplast) [Nicotiana undulata] gi|347454063|gb|AEO95720.1| ribosomal protein L2 [synthetic construct] gi|347454098|gb|AEO95755.1| ribosomal protein L2 [synthetic construct] gi|225238|prf||1211235BW ribosomal protein L2 Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >sp|P21434.1|RK2_NICDE RecName: Full=50S ribosomal protein L2, chloroplastic Length = 266 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_009002296.1| ribosomal protein L2 (chloroplast) [Pinguicula ehlersiae] gi|587005129|ref|YP_009002308.1| ribosomal protein L2 (chloroplast) [Pinguicula ehlersiae] gi|575882179|emb|CDL78852.1| ribosomal protein L2 (chloroplast) [Pinguicula ehlersiae] gi|575882191|emb|CDL78864.1| ribosomal protein L2 (chloroplast) [Pinguicula ehlersiae] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >emb|CCQ71687.1| ribosomal protein L2 (chloroplast) [Salvia miltiorrhiza] Length = 286 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_009000055.1| ribosomal protein L2 (chloroplast) [Silene conoidea] gi|555944143|gb|AGZ18046.1| ribosomal protein L2 (chloroplast) [Silene conoidea] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_008992305.1| ribosomal protein L2 (mitochondrion) [Salvia miltiorrhiza] gi|534292279|gb|AGU16571.1| ribosomal protein L2 (mitochondrion) [Salvia miltiorrhiza] Length = 241 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_008994331.1| ribosomal protein L2 [Melianthus villosus] gi|527355180|gb|AGS13049.1| ribosomal protein L2 [Melianthus villosus] Length = 275 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_008965533.1| ribosomal protein L2 [Pyrus spinosa] gi|565666505|emb|CDI73605.1| ribosomal protein L2 [Pyrus spinosa] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_008963641.1| ribosomal protein L2 (chloroplast) [Lupinus luteus] gi|568244879|ref|YP_008963662.1| ribosomal protein L2 (chloroplast) [Lupinus luteus] gi|485474352|gb|AGK82954.1| ribosomal protein L2 (chloroplast) [Lupinus luteus] gi|485474374|gb|AGK82976.1| ribosomal protein L2 (chloroplast) [Lupinus luteus] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_008964096.1| ribosomal protein L2 [Ajuga reptans] gi|568247132|ref|YP_008964076.1| ribosomal protein L2 [Ajuga reptans] gi|558697175|gb|AHA84930.1| ribosomal protein L2 [Ajuga reptans] gi|558697203|gb|AHA84958.1| ribosomal protein L2 [Ajuga reptans] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_008814985.1| ribosomal protein L2 (chloroplast) [Brassaiopsis hainla] gi|558602978|ref|YP_008815008.1| ribosomal protein L2 (chloroplast) [Brassaiopsis hainla] gi|558603041|ref|YP_008815072.1| ribosomal protein L2 (chloroplast) [Metapanax delavayi] gi|558603066|ref|YP_008815095.1| ribosomal protein L2 (chloroplast) [Metapanax delavayi] gi|558603129|ref|YP_008815159.1| ribosomal protein L2 (chloroplast) [Schefflera delavayi] gi|558603154|ref|YP_008815182.1| ribosomal protein L2 (chloroplast) [Schefflera delavayi] gi|563940320|ref|YP_008814898.1| ribosomal protein L2 (chloroplast) [Aralia undulata] gi|563940345|ref|YP_008814921.1| ribosomal protein L2 (chloroplast) [Aralia undulata] gi|563940426|ref|YP_008815246.1| ribosomal protein L2 (chloroplast) [Kalopanax septemlobus] gi|563940451|ref|YP_008815269.1| ribosomal protein L2 (chloroplast) [Kalopanax septemlobus] gi|458599131|gb|AGG38997.1| ribosomal protein L2 (chloroplast) [Aralia undulata] gi|458599156|gb|AGG39022.1| ribosomal protein L2 (chloroplast) [Aralia undulata] gi|458599233|gb|AGG39084.1| ribosomal protein L2 (chloroplast) [Brassaiopsis hainla] gi|458599258|gb|AGG39109.1| ribosomal protein L2 (chloroplast) [Brassaiopsis hainla] gi|458599412|gb|AGG39171.1| ribosomal protein L2 (chloroplast) [Metapanax delavayi] gi|458599437|gb|AGG39196.1| ribosomal protein L2 (chloroplast) [Metapanax delavayi] gi|458599565|gb|AGG39258.1| ribosomal protein L2 (chloroplast) [Schefflera delavayi] gi|458599590|gb|AGG39283.1| ribosomal protein L2 (chloroplast) [Schefflera delavayi] gi|458599653|gb|AGG39345.1| ribosomal protein L2 (chloroplast) [Kalopanax septemlobus] gi|458599678|gb|AGG39370.1| ribosomal protein L2 (chloroplast) [Kalopanax septemlobus] gi|506444441|gb|AGM15003.1| ribosomal protein S2 (chloroplast) [Panax ginseng] gi|506444442|gb|AGM15004.1| ribosomal protein S2 (chloroplast) [Panax ginseng] gi|506444529|gb|AGM15089.1| ribosomal protein S2 (chloroplast) [Panax ginseng] gi|506444530|gb|AGM15090.1| ribosomal protein S2 (chloroplast) [Panax ginseng] gi|506444645|gb|AGM15175.1| ribosomal protein S2 (chloroplast) [Panax ginseng] gi|506444646|gb|AGM15176.1| ribosomal protein S2 (chloroplast) [Panax ginseng] Length = 275 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >ref|YP_008816000.1| ribosomal protein L2 (chloroplast) [Lindenbergia philippensis] gi|557136927|emb|CDI43981.1| ribosomal protein L2 (chloroplast) [Lindenbergia philippensis] Length = 274 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 62 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 114 >gb|EPS74502.1| hypothetical protein M569_00219 [Genlisea aurea] Length = 286 Score = 115 bits (287), Expect = 8e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 252 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTV 94 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDT+ Sbjct: 59 KIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTI 111