BLASTX nr result
ID: Achyranthes23_contig00042446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00042446 (249 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851081.1| hypothetical protein AMTR_s00025p00243250 [A... 64 2e-08 ref|XP_003555336.1| PREDICTED: long chain acyl-CoA synthetase 6,... 63 5e-08 ref|XP_003535658.1| PREDICTED: long chain acyl-CoA synthetase 6,... 63 5e-08 ref|XP_006408004.1| hypothetical protein EUTSA_v10020181mg [Eutr... 62 8e-08 ref|XP_006297245.1| hypothetical protein CARUB_v10013250mg [Caps... 62 8e-08 ref|NP_566265.1| long-chain acyl-CoA synthetase 6 [Arabidopsis t... 62 8e-08 dbj|BAB40450.1| long-chain acyl-CoA synthetase [Arabidopsis thal... 62 8e-08 ref|XP_002884548.1| long-chain acyl-CoA synthetase [Arabidopsis ... 62 8e-08 ref|XP_002517212.1| Acyl-CoA synthetase [Ricinus communis] gi|83... 62 8e-08 gb|AAF23219.1|AC013454_6 putative long-chain-fatty-acid--CoA lig... 62 8e-08 gb|AAM28873.1|AF503756_1 long chain acyl-CoA synthetase 6 [Arabi... 62 8e-08 gb|ESW15223.1| hypothetical protein PHAVU_007G054900g [Phaseolus... 62 1e-07 ref|XP_004247526.1| PREDICTED: long chain acyl-CoA synthetase 7,... 61 1e-07 ref|XP_003577890.1| PREDICTED: long chain acyl-CoA synthetase 6,... 61 1e-07 ref|XP_004978651.1| PREDICTED: long chain acyl-CoA synthetase 6,... 61 2e-07 ref|XP_004977549.1| PREDICTED: long chain acyl-CoA synthetase 6,... 61 2e-07 ref|XP_004977548.1| PREDICTED: long chain acyl-CoA synthetase 6,... 61 2e-07 ref|XP_004496751.1| PREDICTED: long chain acyl-CoA synthetase 6,... 61 2e-07 ref|XP_004496750.1| PREDICTED: long chain acyl-CoA synthetase 6,... 61 2e-07 ref|XP_002874363.1| long-chain acyl-CoA synthetase 7 [Arabidopsi... 61 2e-07 >ref|XP_006851081.1| hypothetical protein AMTR_s00025p00243250 [Amborella trichopoda] gi|548854752|gb|ERN12662.1| hypothetical protein AMTR_s00025p00243250 [Amborella trichopoda] Length = 696 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -2 Query: 221 IL*GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 IL G +GLYFINRPEWI+VDH S Y FV VPLYDTL +N+ Sbjct: 134 ILKGARIGLYFINRPEWIIVDHACSAYSFVSVPLYDTLGPDAVNY 178 >ref|XP_003555336.1| PREDICTED: long chain acyl-CoA synthetase 6, peroxisomal [Glycine max] Length = 698 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNFCACRMFLQ 63 G+S+GLYFINRPEW++VDH S Y FV VPLYDTL + + +Q Sbjct: 141 GSSIGLYFINRPEWLIVDHACSAYSFVSVPLYDTLGPDAVKYIVSHAVVQ 190 >ref|XP_003535658.1| PREDICTED: long chain acyl-CoA synthetase 6, peroxisomal-like [Glycine max] Length = 696 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTL 108 G+S+GLYFINRPEW++VDH S+Y FV VPLYDTL Sbjct: 139 GSSIGLYFINRPEWLIVDHACSSYSFVSVPLYDTL 173 >ref|XP_006408004.1| hypothetical protein EUTSA_v10020181mg [Eutrema salsugineum] gi|557109150|gb|ESQ49457.1| hypothetical protein EUTSA_v10020181mg [Eutrema salsugineum] Length = 696 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G+SVG+YFINRPEW++VDH S+Y +V VPLYDTL + F Sbjct: 138 GSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPDAVKF 179 >ref|XP_006297245.1| hypothetical protein CARUB_v10013250mg [Capsella rubella] gi|482565954|gb|EOA30143.1| hypothetical protein CARUB_v10013250mg [Capsella rubella] Length = 610 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G+SVG+YFINRPEW++VDH S+Y +V VPLYDTL + F Sbjct: 140 GSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPDAVKF 181 >ref|NP_566265.1| long-chain acyl-CoA synthetase 6 [Arabidopsis thaliana] gi|75301664|sp|Q8LPS1.1|LACS6_ARATH RecName: Full=Long chain acyl-CoA synthetase 6, peroxisomal; Flags: Precursor gi|20453099|gb|AAM19792.1| AT3g05970/F2O10_9 [Arabidopsis thaliana] gi|24796992|gb|AAN64508.1| At3g05970/F2O10_9 [Arabidopsis thaliana] gi|332640803|gb|AEE74324.1| long-chain acyl-CoA synthetase 6 [Arabidopsis thaliana] Length = 701 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G+SVG+YFINRPEW++VDH S+Y +V VPLYDTL + F Sbjct: 143 GSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPDAVKF 184 >dbj|BAB40450.1| long-chain acyl-CoA synthetase [Arabidopsis thaliana] Length = 701 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G+SVG+YFINRPEW++VDH S+Y +V VPLYDTL + F Sbjct: 143 GSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPDAVKF 184 >ref|XP_002884548.1| long-chain acyl-CoA synthetase [Arabidopsis lyrata subsp. lyrata] gi|297330388|gb|EFH60807.1| long-chain acyl-CoA synthetase [Arabidopsis lyrata subsp. lyrata] Length = 695 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G+SVG+YFINRPEW++VDH S+Y +V VPLYDTL + F Sbjct: 141 GSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPDAVKF 182 >ref|XP_002517212.1| Acyl-CoA synthetase [Ricinus communis] gi|83320525|gb|ABC02881.1| ACS2 [Ricinus communis] gi|223543847|gb|EEF45375.1| Acyl-CoA synthetase [Ricinus communis] Length = 694 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G+SVGLYFINRPEW++VDH S Y ++ VPLYDTL + F Sbjct: 138 GSSVGLYFINRPEWLIVDHACSAYSYISVPLYDTLGPDAVKF 179 >gb|AAF23219.1|AC013454_6 putative long-chain-fatty-acid--CoA ligase [Arabidopsis thaliana] Length = 657 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G+SVG+YFINRPEW++VDH S+Y +V VPLYDTL + F Sbjct: 143 GSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPDAVKF 184 >gb|AAM28873.1|AF503756_1 long chain acyl-CoA synthetase 6 [Arabidopsis thaliana] Length = 701 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G+SVG+YFINRPEW++VDH S+Y +V VPLYDTL + F Sbjct: 143 GSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPDAVKF 184 >gb|ESW15223.1| hypothetical protein PHAVU_007G054900g [Phaseolus vulgaris] Length = 696 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTL 108 G+SVGLYFINRPEW+++DH S Y FV VPLYDTL Sbjct: 139 GSSVGLYFINRPEWLILDHACSAYSFVSVPLYDTL 173 >ref|XP_004247526.1| PREDICTED: long chain acyl-CoA synthetase 7, peroxisomal-like [Solanum lycopersicum] Length = 698 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNFCA 81 G+ VGLYFINRPEW++VDH S Y F+ VPLYDTL + + A Sbjct: 140 GSRVGLYFINRPEWLIVDHACSAYSFISVPLYDTLGPEAVKYIA 183 >ref|XP_003577890.1| PREDICTED: long chain acyl-CoA synthetase 6, peroxisomal-like [Brachypodium distachyon] Length = 697 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 G SVGLYFINRPEWI+ DH S Y +V VPLYDTL + F Sbjct: 140 GASVGLYFINRPEWIIADHACSAYSYVSVPLYDTLGPDAVQF 181 >ref|XP_004978651.1| PREDICTED: long chain acyl-CoA synthetase 6, peroxisomal-like [Setaria italica] Length = 703 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -2 Query: 221 IL*GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 IL G +GLYFINRPEWI+VDH + Y +V VPLYDTL + F Sbjct: 143 ILEGARIGLYFINRPEWIIVDHACAAYSYVSVPLYDTLGPDAVQF 187 >ref|XP_004977549.1| PREDICTED: long chain acyl-CoA synthetase 6, peroxisomal-like isoform X2 [Setaria italica] Length = 627 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 221 IL*GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 +L G +GLYFINRPEWI+VDH ++Y +V VPLYDTL + F Sbjct: 133 VLEGARIGLYFINRPEWIIVDHACASYSYVSVPLYDTLGPDAVQF 177 >ref|XP_004977548.1| PREDICTED: long chain acyl-CoA synthetase 6, peroxisomal-like isoform X1 [Setaria italica] Length = 693 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 221 IL*GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNF 87 +L G +GLYFINRPEWI+VDH ++Y +V VPLYDTL + F Sbjct: 133 VLEGARIGLYFINRPEWIIVDHACASYSYVSVPLYDTLGPDAVQF 177 >ref|XP_004496751.1| PREDICTED: long chain acyl-CoA synthetase 6, peroxisomal-like isoform X2 [Cicer arietinum] Length = 609 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTL 108 G+ VGLYFINRPEW++VDH S Y F+ VPLYDTL Sbjct: 139 GSGVGLYFINRPEWLIVDHACSAYSFISVPLYDTL 173 >ref|XP_004496750.1| PREDICTED: long chain acyl-CoA synthetase 6, peroxisomal-like isoform X1 [Cicer arietinum] Length = 696 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTL 108 G+ VGLYFINRPEW++VDH S Y F+ VPLYDTL Sbjct: 139 GSGVGLYFINRPEWLIVDHACSAYSFISVPLYDTL 173 >ref|XP_002874363.1| long-chain acyl-CoA synthetase 7 [Arabidopsis lyrata subsp. lyrata] gi|297320200|gb|EFH50622.1| long-chain acyl-CoA synthetase 7 [Arabidopsis lyrata subsp. lyrata] Length = 699 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/50 (56%), Positives = 32/50 (64%) Frame = -2 Query: 212 GTSVGLYFINRPEWIVVDHVYSTYYFVLVPLYDTLSKIPLNFCACRMFLQ 63 G VGLYFINRPEW+VVDH + Y F+ VPLYDTL + F LQ Sbjct: 142 GACVGLYFINRPEWLVVDHACAAYSFISVPLYDTLGPDAVKFVVNHATLQ 191