BLASTX nr result
ID: Achyranthes23_contig00042410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00042410 (355 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB63565.1| Kinesin-like protein KIF15 [Morus notabilis] 49 2e-06 >gb|EXB63565.1| Kinesin-like protein KIF15 [Morus notabilis] Length = 2985 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 22/46 (47%), Positives = 31/46 (67%) Frame = +3 Query: 69 QHKITNERVKLAELMPXXXXXXXXXXXXXQTPRRTSQSPFFSAVDR 206 ++KITNER++L+ELMP QTP+R SQ+P+FS +DR Sbjct: 2940 KNKITNERIRLSELMPQSSPISSRADENRQTPKRVSQAPYFSPLDR 2985 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +2 Query: 2 EALQKLVFQVTSLERELEDLNY 67 E L++L ++TS++RE+EDL Y Sbjct: 2918 EVLEQLKNKITSMDREIEDLKY 2939