BLASTX nr result
ID: Achyranthes23_contig00042105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00042105 (577 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlise... 58 1e-06 >gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 57.8 bits (138), Expect(2) = 1e-06 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -2 Query: 129 LVLFPQSHRVRHRFIKKIH-SFDCMMDSPEKHWRACKRGALPTE 1 ++LF QS+ VRHR +I F+ MM+SPEK WRACKRGALPTE Sbjct: 44 MLLFSQSYGVRHRLQDQISIDFEWMMESPEKPWRACKRGALPTE 87 Score = 20.8 bits (42), Expect(2) = 1e-06 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 233 VFTLSISQINNGFY 192 VFT ISQI +G Y Sbjct: 17 VFTFQISQIVDGVY 30