BLASTX nr result
ID: Achyranthes23_contig00041863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00041863 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK33858.1| unknown [Lotus japonicus] 84 1e-14 gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] 83 3e-14 ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria... 82 7e-14 gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus pe... 82 1e-13 ref|XP_006425592.1| hypothetical protein CICLE_v10026781mg [Citr... 81 2e-13 ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citr... 81 2e-13 ref|XP_004232447.1| PREDICTED: thioredoxin H-type 2-like [Solanu... 80 3e-13 ref|NP_001275313.1| thioredoxin H-type 2-like [Solanum tuberosum... 80 3e-13 sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Shor... 80 3e-13 gb|ACU14225.1| unknown [Glycine max] 80 4e-13 ref|XP_002310830.2| thioredoxin h family protein [Populus tricho... 79 8e-13 ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|111... 78 1e-12 ref|NP_001238579.1| uncharacterized protein LOC100499701 [Glycin... 78 1e-12 ref|XP_004291829.1| PREDICTED: thioredoxin H-type-like [Fragaria... 78 1e-12 gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] 78 1e-12 ref|XP_006403964.1| hypothetical protein EUTSA_v10010795mg [Eutr... 77 2e-12 ref|XP_004512082.1| PREDICTED: thioredoxin H-type-like [Cicer ar... 77 2e-12 ref|NP_001237535.1| thioredoxin h1 [Glycine max] gi|157781191|gb... 77 2e-12 ref|XP_004158908.1| PREDICTED: thioredoxin H-type-like [Cucumis ... 77 3e-12 ref|XP_004149979.1| PREDICTED: thioredoxin H-type-like [Cucumis ... 77 3e-12 >gb|AFK33858.1| unknown [Lotus japonicus] Length = 121 Score = 84.3 bits (207), Expect = 1e-14 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA DWA+E MPTF F+ +G IVD VVGAKK+ELQQK+EK+ +TASA Sbjct: 68 VDVDELKSVAQDWAVEAMPTFMFVKEGSIVDKVVGAKKEELQQKIEKHVATASA 121 >gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] Length = 118 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELKEVA+DWA+E MPTF F+ +GKIVD VVGAKKD+LQQ V K+ ++ASA Sbjct: 65 VDVDELKEVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDDLQQTVAKHMASASA 118 >ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca] Length = 118 Score = 82.0 bits (201), Expect = 7e-14 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 +DVDELK VA DWA+E MPTF F+ +GKIVD VVGAKK+ELQQ V K+ +TASA Sbjct: 65 IDVDELKSVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTVAKHVATASA 118 >gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica] Length = 120 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA DWA+E MPTF F+ +GKIVD VVGAKKDELQQ + K+ + ASA Sbjct: 65 VDVDELKSVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHVAAASA 118 >ref|XP_006425592.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|557527582|gb|ESR38832.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] Length = 120 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA+DWA+E MPTF F+ +GKIVD VVG+KK+ELQQ + K+ +TASA Sbjct: 67 VDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA 120 >ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|568824998|ref|XP_006466877.1| PREDICTED: thioredoxin H-type-like [Citrus sinensis] gi|119367477|gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] gi|557527581|gb|ESR38831.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] Length = 119 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA+DWA+E MPTF F+ +GKIVD VVG+KK+ELQQ + K+ +TASA Sbjct: 66 VDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA 119 >ref|XP_004232447.1| PREDICTED: thioredoxin H-type 2-like [Solanum lycopersicum] Length = 118 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA+DWA+E MPTF F+ +GKIVD VVGAKKDELQQ + K+ S+ S+ Sbjct: 64 VDVDELKSVATDWAVEAMPTFMFIKEGKIVDKVVGAKKDELQQTIAKHISSTSS 117 >ref|NP_001275313.1| thioredoxin H-type 2-like [Solanum tuberosum] gi|418730025|gb|AFX66981.1| thioredoxin H-type 2 [Solanum tuberosum] Length = 118 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA+DWA+E MPTF F+ +GKIVD VVGAKKDELQQ + K+ S+ S+ Sbjct: 64 VDVDELKSVATDWAVEAMPTFMFIKEGKIVDKVVGAKKDELQQTIAKHISSTSS 117 >sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Short=Trx-H2 gi|297519|emb|CAA77847.1| THIOREDOXIN [Nicotiana tabacum] gi|447151|prf||1913431A thioredoxin Length = 118 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTAS 159 VDVDELK VA+DWA+E MPTF F+ +GKIVD VVGAKKDELQQ + K+ S+ S Sbjct: 64 VDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHISSTS 116 >gb|ACU14225.1| unknown [Glycine max] Length = 120 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/54 (66%), Positives = 46/54 (85%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK V+ DWAIE MPTF F+ +G ++D VVGAKKDELQQK++K+ ++ASA Sbjct: 67 VDVDELKSVSQDWAIEAMPTFVFVKEGTLLDKVVGAKKDELQQKIQKHVASASA 120 >ref|XP_002310830.2| thioredoxin h family protein [Populus trichocarpa] gi|118481453|gb|ABK92669.1| unknown [Populus trichocarpa] gi|550334812|gb|EEE91280.2| thioredoxin h family protein [Populus trichocarpa] Length = 122 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA DWA+E MPTF F+ +GKIVD VVGA+KDELQQ + K+ + A+A Sbjct: 65 VDVDELKTVAQDWAVEAMPTFMFLKEGKIVDKVVGARKDELQQAIAKHTAPAAA 118 >ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|11135282|sp|Q43636.1|TRXH_RICCO RecName: Full=Thioredoxin H-type; Short=Trx-H gi|1255954|emb|CAA94534.1| thioredoxin [Ricinus communis] gi|223525803|gb|EEF28248.1| Thioredoxin H-type [Ricinus communis] Length = 118 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTAS 159 VDVDELK VA +WA+E MPTF F+ +GKI+D VVGAKKDELQQ + K+ +TAS Sbjct: 65 VDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKHMATAS 117 >ref|NP_001238579.1| uncharacterized protein LOC100499701 [Glycine max] gi|255625907|gb|ACU13298.1| unknown [Glycine max] Length = 120 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK V+ DWAIE MPTF F+ +G ++ VVGAKKDELQQ +EKY ++ASA Sbjct: 67 VDVDELKSVSQDWAIEAMPTFVFVKEGTLLSKVVGAKKDELQQTIEKYVASASA 120 >ref|XP_004291829.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca] Length = 122 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK+VA DWA+E MPTF F+ +GKIVD VVGAKKDEL QKV ++A+ A Sbjct: 65 VDVDELKKVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKDELVQKVGQHAAACVA 118 >gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] Length = 118 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/54 (64%), Positives = 44/54 (81%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA DWA+E MPTF F+ +GKI+D VVGAKK+ELQQ + K+A+ +A Sbjct: 64 VDVDELKTVAEDWAVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKHATEVAA 117 >ref|XP_006403964.1| hypothetical protein EUTSA_v10010795mg [Eutrema salsugineum] gi|557105083|gb|ESQ45417.1| hypothetical protein EUTSA_v10010795mg [Eutrema salsugineum] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKY 144 VD+DELK VASDWAIE MPTF FM +GKIVD VVGAKKDELQ + K+ Sbjct: 103 VDIDELKSVASDWAIEAMPTFMFMKEGKIVDKVVGAKKDELQSTITKH 150 >ref|XP_004512082.1| PREDICTED: thioredoxin H-type-like [Cicer arietinum] Length = 120 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/54 (64%), Positives = 45/54 (83%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK VA DWA+E MPTF F+ +G I+D VVGAKK+ELQQ +EK+ ++A+A Sbjct: 67 VDVDELKSVAQDWAVEAMPTFVFVKEGTILDKVVGAKKEELQQTIEKHVASANA 120 >ref|NP_001237535.1| thioredoxin h1 [Glycine max] gi|157781191|gb|ABV71991.1| thioredoxin h1 [Glycine max] Length = 120 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/54 (62%), Positives = 46/54 (85%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDELK V+ DWAIE MPTF F+ +G ++D VVGAKKDELQQK++K+ ++++A Sbjct: 67 VDVDELKSVSQDWAIEAMPTFVFVKEGTLLDKVVGAKKDELQQKIQKHVASSNA 120 >ref|XP_004158908.1| PREDICTED: thioredoxin H-type-like [Cucumis sativus] Length = 90 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/54 (64%), Positives = 44/54 (81%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDEL+ VA DW +E MPTF F+ +G+I+D VVGAKK+ELQQ V K+ +TASA Sbjct: 37 VDVDELESVAKDWGVEAMPTFMFLKEGRILDKVVGAKKEELQQTVAKHLATASA 90 >ref|XP_004149979.1| PREDICTED: thioredoxin H-type-like [Cucumis sativus] Length = 122 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/54 (64%), Positives = 44/54 (81%) Frame = +1 Query: 1 VDVDELKEVASDWAIEGMPTFKFMHDGKIVDTVVGAKKDELQQKVEKYASTASA 162 VDVDEL+ VA DW +E MPTF F+ +G+I+D VVGAKK+ELQQ V K+ +TASA Sbjct: 69 VDVDELESVAKDWGVEAMPTFMFLKEGRILDKVVGAKKEELQQTVAKHLATASA 122