BLASTX nr result
ID: Achyranthes23_contig00041719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00041719 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846010.1| hypothetical protein AMTR_s00155p00067560 [A... 55 1e-05 >ref|XP_006846010.1| hypothetical protein AMTR_s00155p00067560 [Amborella trichopoda] gi|548848766|gb|ERN07685.1| hypothetical protein AMTR_s00155p00067560 [Amborella trichopoda] Length = 234 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = -1 Query: 258 VEEEDQGAEPPRRMGAIRLMYALGKEAPN---PTRATAKRMFVDVEVNG*QARALLDIGA 88 V+E DQ EP +MGAIR++ A+ A + ++ T + M+VD+++NG A++D GA Sbjct: 130 VDESDQEEEP--KMGAIRILNAIKAHALDVQPASKTTKELMYVDIQLNGRSTMAMVDTGA 187 Query: 87 SHNYLSRREATGLG 46 +HN++S EA LG Sbjct: 188 THNFISGDEAKRLG 201