BLASTX nr result
ID: Achyranthes23_contig00041167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00041167 (476 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD83317.1| Fgenesh protein 73 [Beta vulgaris] 65 1e-08 >gb|ABD83317.1| Fgenesh protein 73 [Beta vulgaris] Length = 412 Score = 64.7 bits (156), Expect = 1e-08 Identities = 40/113 (35%), Positives = 61/113 (53%), Gaps = 1/113 (0%) Frame = +3 Query: 141 EEDEALPKQAPYFTKLLSQFVL*QPFTQLISQPLTQPPPSKSFGSTR-WDLVEDIAMISS 317 ++D+ + F++LLS QP + Q P P+ S + R WD VED ++S+ Sbjct: 112 DDDDEFVQGTQSFSQLLSGNQSQQPPQRQPVQSQNPPFPATSSSAKRVWDQVEDELLVSA 171 Query: 318 IMNTCSDAIVGTNQKARVM*GKVVKAFEEARPARPAIS*RTHDMIIKSRWNRM 476 MNT D + GT QK + GKV +AFEE R A P + + ++K RW+R+ Sbjct: 172 FMNTSLDKVSGTYQKKNIFWGKVWEAFEEGRIANPTETAPRNVDMVKGRWSRL 224