BLASTX nr result
ID: Achyranthes23_contig00040853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00040853 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004960248.1| PREDICTED: auxin-responsive protein IAA33-li... 57 3e-06 ref|XP_006474183.1| PREDICTED: auxin-responsive protein IAA33-li... 56 6e-06 ref|XP_006453372.1| hypothetical protein CICLE_v10010470mg [Citr... 56 6e-06 ref|XP_002532238.1| transcription factor, putative [Ricinus comm... 56 6e-06 ref|XP_002864517.1| indoleacetic acid-induced protein 33 [Arabid... 55 7e-06 >ref|XP_004960248.1| PREDICTED: auxin-responsive protein IAA33-like [Setaria italica] Length = 163 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 LLLAGDLKWKDFVRVAKRIRIMPVKSSSRKQK 98 LLLAGDLKW DFVRVAKRIRI+PVK SSR +K Sbjct: 125 LLLAGDLKWNDFVRVAKRIRIIPVKKSSRTKK 156 >ref|XP_006474183.1| PREDICTED: auxin-responsive protein IAA33-like [Citrus sinensis] Length = 169 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 LLLAGDLKWKDFVRVAKRIRIMPVKSSSRK 92 LLLAGDL WKDFVRVAKRIRI+PVK +SRK Sbjct: 134 LLLAGDLNWKDFVRVAKRIRILPVKGNSRK 163 >ref|XP_006453372.1| hypothetical protein CICLE_v10010470mg [Citrus clementina] gi|557556598|gb|ESR66612.1| hypothetical protein CICLE_v10010470mg [Citrus clementina] Length = 181 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 LLLAGDLKWKDFVRVAKRIRIMPVKSSSRK 92 LLLAGDL WKDFVRVAKRIRI+PVK +SRK Sbjct: 146 LLLAGDLNWKDFVRVAKRIRILPVKGNSRK 175 >ref|XP_002532238.1| transcription factor, putative [Ricinus communis] gi|223528072|gb|EEF30147.1| transcription factor, putative [Ricinus communis] Length = 173 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 LLLAGDLKWKDFVRVAKRIRIMPVKSSSRK 92 LLLAGDL WKDFVRVAKRIRI+PVK +SRK Sbjct: 139 LLLAGDLNWKDFVRVAKRIRILPVKGNSRK 168 >ref|XP_002864517.1| indoleacetic acid-induced protein 33 [Arabidopsis lyrata subsp. lyrata] gi|297310352|gb|EFH40776.1| indoleacetic acid-induced protein 33 [Arabidopsis lyrata subsp. lyrata] Length = 171 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 LLLAGDLKWKDFVRVAKRIRIMPVKSSSRKQK 98 LLLAGDL WKDFVRVAKRIRI+PVK ++RK K Sbjct: 137 LLLAGDLTWKDFVRVAKRIRILPVKGNTRKVK 168