BLASTX nr result
ID: Achyranthes23_contig00040624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00040624 (230 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 47 1e-05 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 46.6 bits (109), Expect(2) = 1e-05 Identities = 29/68 (42%), Positives = 35/68 (51%) Frame = -1 Query: 230 SAWP*WAGPQHVLQWQCNNPPGISFEQGLKAERMERLAIMVRMGLCY*IRK*ESQVIAEQ 51 SAWP WAGP N +QG KAER+ + + L K ES VIA+Q Sbjct: 423 SAWPLWAGPHTCYNGNYNG------KQGCKAERIRKDCLSSDCSLQLGNMKLESLVIADQ 476 Query: 50 HAAVNLVP 27 HAAVN+ P Sbjct: 477 HAAVNMYP 484 Score = 28.1 bits (61), Expect(2) = 1e-05 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 31 YPGPVHTARH 2 YPGPVHTARH Sbjct: 483 YPGPVHTARH 492