BLASTX nr result
ID: Achyranthes23_contig00040558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00040558 (203 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC26385.1| hypothetical protein L484_006436 [Morus notabilis] 56 4e-06 >gb|EXC26385.1| hypothetical protein L484_006436 [Morus notabilis] Length = 620 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 2/69 (2%) Frame = +3 Query: 3 AMRIVSSSPVDRFHRLFMGSTYNGMTSFSFK-AYSGNENIC-TASNTPPAADSCSFQSWI 176 +MR+VSSSPV H+ M + G+ SF F+ A SG++N +A T + S F SW+ Sbjct: 235 SMRVVSSSPVSWIHKSLMSCAFTGLPSFGFQIACSGDKNRSNSAGLTSTSHSSKIFHSWV 294 Query: 177 YPQSSLPAS 203 YPQS+LP S Sbjct: 295 YPQSTLPPS 303