BLASTX nr result
ID: Achyranthes23_contig00040235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00040235 (466 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB88750.1| gag protein [Silene latifolia] 62 1e-07 >dbj|BAB88750.1| gag protein [Silene latifolia] Length = 196 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/69 (40%), Positives = 41/69 (59%) Frame = -2 Query: 222 PVAVEVVDGYAQSPFVDELARVRIPKKVNIPPSKLYDGSIDPVDHVAHYKQRMWQLPIPF 43 P+ D YA SPFVD+++ + +PK + P LYDG+ DP DH+++ KQ+M + Sbjct: 97 PMERATTDSYADSPFVDQISLITVPKGFSAPTMTLYDGTTDPYDHISYLKQKMMVITAVG 156 Query: 42 NLMEATMCK 16 L EA M K Sbjct: 157 ALKEACMYK 165