BLASTX nr result
ID: Achyranthes23_contig00040132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00040132 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006438961.1| hypothetical protein CICLE_v10031947mg [Citr... 62 1e-07 ref|XP_003633515.1| PREDICTED: bifunctional dihydroflavonol 4-re... 61 2e-07 ref|XP_002314053.2| putative cinnamoyl-CoA reductase family prot... 60 2e-07 ref|XP_006379089.1| hypothetical protein POPTR_0009s06260g [Popu... 60 2e-07 ref|XP_006379088.1| hypothetical protein POPTR_0009s06260g [Popu... 60 2e-07 ref|XP_006379087.1| hypothetical protein POPTR_0009s06260g [Popu... 60 2e-07 ref|XP_006379086.1| hypothetical protein POPTR_0009s06260g [Popu... 60 2e-07 gb|ESW03540.1| hypothetical protein PHAVU_011G022300g [Phaseolus... 60 3e-07 gb|AFK48895.1| unknown [Medicago truncatula] 60 3e-07 ref|XP_003607374.1| Dihydroflavonol-4-reductase [Medicago trunca... 60 3e-07 ref|XP_006482922.1| PREDICTED: tetraketide alpha-pyrone reductas... 60 4e-07 emb|CAN62118.1| hypothetical protein VITISV_011014 [Vitis vinifera] 60 4e-07 ref|XP_004308687.1| PREDICTED: uncharacterized protein LOC101310... 59 5e-07 ref|XP_003633518.1| PREDICTED: bifunctional dihydroflavonol 4-re... 59 5e-07 ref|XP_003633516.1| PREDICTED: bifunctional dihydroflavonol 4-re... 59 5e-07 ref|XP_002274632.1| PREDICTED: bifunctional dihydroflavonol 4-re... 59 5e-07 ref|NP_001234838.1| alcohol dehydrogenase-like [Solanum lycopers... 59 7e-07 ref|XP_006482921.1| PREDICTED: tetraketide alpha-pyrone reductas... 58 1e-06 ref|XP_006482920.1| PREDICTED: tetraketide alpha-pyrone reductas... 58 1e-06 ref|XP_006482918.1| PREDICTED: tetraketide alpha-pyrone reductas... 58 1e-06 >ref|XP_006438961.1| hypothetical protein CICLE_v10031947mg [Citrus clementina] gi|557541157|gb|ESR52201.1| hypothetical protein CICLE_v10031947mg [Citrus clementina] Length = 353 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 100 REKMSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 RE MS EGKVVCVTGASG+IASWLVKLLLQR Y Sbjct: 30 REPMSGEGKVVCVTGASGFIASWLVKLLLQRSY 62 >ref|XP_003633515.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296085368|emb|CBI29100.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MS +GKVVCVTGASGYIASWLVKLLLQRGY Sbjct: 1 MSGQGKVVCVTGASGYIASWLVKLLLQRGY 30 >ref|XP_002314053.2| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa] gi|550331154|gb|EEE88008.2| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa] Length = 326 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MS+EGKVVCVTGASGYIASWLVKLLL RGY Sbjct: 1 MSAEGKVVCVTGASGYIASWLVKLLLHRGY 30 >ref|XP_006379089.1| hypothetical protein POPTR_0009s06260g [Populus trichocarpa] gi|550331153|gb|ERP56886.1| hypothetical protein POPTR_0009s06260g [Populus trichocarpa] Length = 279 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MS+EGKVVCVTGASGYIASWLVKLLL RGY Sbjct: 1 MSAEGKVVCVTGASGYIASWLVKLLLHRGY 30 >ref|XP_006379088.1| hypothetical protein POPTR_0009s06260g [Populus trichocarpa] gi|550331152|gb|ERP56885.1| hypothetical protein POPTR_0009s06260g [Populus trichocarpa] Length = 232 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MS+EGKVVCVTGASGYIASWLVKLLL RGY Sbjct: 1 MSAEGKVVCVTGASGYIASWLVKLLLHRGY 30 >ref|XP_006379087.1| hypothetical protein POPTR_0009s06260g [Populus trichocarpa] gi|550331151|gb|ERP56884.1| hypothetical protein POPTR_0009s06260g [Populus trichocarpa] Length = 226 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MS+EGKVVCVTGASGYIASWLVKLLL RGY Sbjct: 1 MSAEGKVVCVTGASGYIASWLVKLLLHRGY 30 >ref|XP_006379086.1| hypothetical protein POPTR_0009s06260g [Populus trichocarpa] gi|550331150|gb|ERP56883.1| hypothetical protein POPTR_0009s06260g [Populus trichocarpa] Length = 237 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MS+EGKVVCVTGASGYIASWLVKLLL RGY Sbjct: 1 MSAEGKVVCVTGASGYIASWLVKLLLHRGY 30 >gb|ESW03540.1| hypothetical protein PHAVU_011G022300g [Phaseolus vulgaris] Length = 324 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MSSEGK+VCVTGASGYIASW+VK LLQRGY Sbjct: 1 MSSEGKLVCVTGASGYIASWIVKFLLQRGY 30 >gb|AFK48895.1| unknown [Medicago truncatula] Length = 229 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 88 SSEGKVVCVTGASGYIASWLVKLLLQRGY 2 SSEGKVVCVTGASGYIASWLVK LLQRGY Sbjct: 3 SSEGKVVCVTGASGYIASWLVKFLLQRGY 31 >ref|XP_003607374.1| Dihydroflavonol-4-reductase [Medicago truncatula] gi|355508429|gb|AES89571.1| Dihydroflavonol-4-reductase [Medicago truncatula] Length = 325 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 88 SSEGKVVCVTGASGYIASWLVKLLLQRGY 2 SSEGKVVCVTGASGYIASWLVK LLQRGY Sbjct: 3 SSEGKVVCVTGASGYIASWLVKFLLQRGY 31 >ref|XP_006482922.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform X2 [Citrus sinensis] Length = 326 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 97 EKMSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 E MS EGKVVCVTGASG+IASWLVKLLLQR Y Sbjct: 4 EPMSGEGKVVCVTGASGFIASWLVKLLLQRSY 35 >emb|CAN62118.1| hypothetical protein VITISV_011014 [Vitis vinifera] Length = 258 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MS +GK+VCVTGASGYIASWLVKLLLQRGY Sbjct: 1 MSEQGKLVCVTGASGYIASWLVKLLLQRGY 30 >ref|XP_004308687.1| PREDICTED: uncharacterized protein LOC101310561 [Fragaria vesca subsp. vesca] Length = 634 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 94 KMSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 +M EGKVVCVTGASG+IASWLVKLLLQRGY Sbjct: 309 EMDGEGKVVCVTGASGFIASWLVKLLLQRGY 339 >ref|XP_003633518.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 2 [Vitis vinifera] Length = 259 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 M +GKVVCVTGASGYIASWLVKLLLQRGY Sbjct: 1 MDGQGKVVCVTGASGYIASWLVKLLLQRGY 30 >ref|XP_003633516.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296085371|emb|CBI29103.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 M +GKVVCVTGASGYIASWLVKLLLQRGY Sbjct: 1 MDGQGKVVCVTGASGYIASWLVKLLLQRGY 30 >ref|XP_002274632.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 1 [Vitis vinifera] gi|296085398|emb|CBI29130.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 M +GKVVCVTGASGYIASWLVKLLLQRGY Sbjct: 1 MDGQGKVVCVTGASGYIASWLVKLLLQRGY 30 >ref|NP_001234838.1| alcohol dehydrogenase-like [Solanum lycopersicum] gi|148888529|gb|ABR15770.1| putative alcohol dehydrogenase [Solanum lycopersicum] Length = 328 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 94 KMSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 K EGKVVCVTGASGYIASWLVKLLLQRGY Sbjct: 4 KNIGEGKVVCVTGASGYIASWLVKLLLQRGY 34 >ref|XP_006482921.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform X1 [Citrus sinensis] Length = 321 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 91 MSSEGKVVCVTGASGYIASWLVKLLLQRGY 2 MS EGKVVCVTGASG+IASWLVKLLLQR Y Sbjct: 1 MSGEGKVVCVTGASGFIASWLVKLLLQRSY 30 >ref|XP_006482920.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform X3 [Citrus sinensis] Length = 650 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 3/36 (8%) Frame = -3 Query: 100 REKMSS---EGKVVCVTGASGYIASWLVKLLLQRGY 2 RE M S EGKVVCVTGASG+IASWLVKLLLQRGY Sbjct: 19 REMMMSGEGEGKVVCVTGASGFIASWLVKLLLQRGY 54 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 2/34 (5%) Frame = -3 Query: 97 EKMSSEG--KVVCVTGASGYIASWLVKLLLQRGY 2 E MS EG KVVCVTGASG++ASWLVKLLLQRGY Sbjct: 328 EMMSGEGEEKVVCVTGASGFVASWLVKLLLQRGY 361 >ref|XP_006482918.1| PREDICTED: tetraketide alpha-pyrone reductase 1-like isoform X1 [Citrus sinensis] Length = 344 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 3/36 (8%) Frame = -3 Query: 100 REKMSS---EGKVVCVTGASGYIASWLVKLLLQRGY 2 RE M S EGKVVCVTGASG+IASWLVKLLLQRGY Sbjct: 19 REMMMSGEGEGKVVCVTGASGFIASWLVKLLLQRGY 54