BLASTX nr result
ID: Achyranthes23_contig00040127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00040127 (571 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484314.1| PREDICTED: uncharacterized protein LOC102615... 57 3e-06 ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago ... 57 4e-06 gb|EXC31162.1| hypothetical protein L484_004928 [Morus notabilis] 56 7e-06 >ref|XP_006484314.1| PREDICTED: uncharacterized protein LOC102615740 [Citrus sinensis] Length = 82 Score = 57.4 bits (137), Expect = 3e-06 Identities = 34/72 (47%), Positives = 45/72 (62%) Frame = -1 Query: 484 QIKMRLRRGSSRPPMKVRRSHEALTRKLRKLQRIIPAAQNNTQLDHLFLHTADYILHLRL 305 ++K R RR S V R ++ K+ KLQ++IP Q Q D LFL TADYI+HL L Sbjct: 13 KVKWRRRRRRSA----VARPSASVRMKVTKLQKLIPGGQG-LQPDRLFLRTADYIVHLNL 67 Query: 304 QIYLLQALFKLY 269 Q+ +LQAL K+Y Sbjct: 68 QLNVLQALSKIY 79 >ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|357516789|ref|XP_003628683.1| hypothetical protein MTR_8g063410 [Medicago truncatula] gi|355478488|gb|AES59691.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|355522705|gb|AET03159.1| hypothetical protein MTR_8g063410 [Medicago truncatula] Length = 72 Score = 56.6 bits (135), Expect = 4e-06 Identities = 33/73 (45%), Positives = 48/73 (65%) Frame = -1 Query: 484 QIKMRLRRGSSRPPMKVRRSHEALTRKLRKLQRIIPAAQNNTQLDHLFLHTADYILHLRL 305 ++KM+L+R RR A+ RK++KLQRIIP + + D LFL TA++IL LRL Sbjct: 8 KLKMKLKRR--------RRREVAVGRKMKKLQRIIPGG-DGLKADQLFLRTAEHILQLRL 58 Query: 304 QIYLLQALFKLYS 266 Q+ LQAL K+++ Sbjct: 59 QLNALQALTKIFN 71 >gb|EXC31162.1| hypothetical protein L484_004928 [Morus notabilis] Length = 82 Score = 55.8 bits (133), Expect = 7e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -1 Query: 415 LTRKLRKLQRIIPAAQNNTQLDHLFLHTADYILHLRLQIYLLQALFKLY 269 L KL +LQRIIP Q + D L +HTADYILHLRLQ+ +L+AL KL+ Sbjct: 33 LKMKLHRLQRIIPGGQG-LKPDQLMVHTADYILHLRLQLCVLEALLKLH 80