BLASTX nr result
ID: Achyranthes23_contig00039943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00039943 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW18806.1| hypothetical protein PHAVU_006G071800g [Phaseolus... 55 7e-06 >gb|ESW18806.1| hypothetical protein PHAVU_006G071800g [Phaseolus vulgaris] Length = 182 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/88 (37%), Positives = 50/88 (56%) Frame = -2 Query: 264 DANAKNALKYCSGIYSGVPGELGTGFDALKLGAFDTANARVSAAMKATITCTNEIKDMKE 85 D AK L+ C +YS +L ALK DTA+ R+SA++ ++TC ++ KD K Sbjct: 93 DEYAKVCLRDCYDLYSDSLWDLDAAAVALKWKDLDTASIRLSASLDNSVTCEDQFKDKKG 152 Query: 84 DAISDVRKEINDFYQLGAICLGFIKLLR 1 + S + KE ++QL I L FI++LR Sbjct: 153 ET-SPLTKENKLYFQLNVISLAFIQMLR 179