BLASTX nr result
ID: Achyranthes23_contig00039826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00039826 (256 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515700.1| huntingtin interacting protein, putative [Ri... 57 2e-06 >ref|XP_002515700.1| huntingtin interacting protein, putative [Ricinus communis] gi|223545137|gb|EEF46647.1| huntingtin interacting protein, putative [Ricinus communis] Length = 2430 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/90 (35%), Positives = 54/90 (60%), Gaps = 6/90 (6%) Frame = -1 Query: 253 SPLDRSRPSNHRQTSR----SEVSETKQNDRVQEEKVTEKIRNDKDSTMSTKETLNVNAM 86 SPLDR RP+NHR+ SR SE ++ ++ +E+K+ +K +++DS KE+ + N + Sbjct: 553 SPLDRGRPNNHREASRKGGVSEKRNSQNANKGKEDKLNQKDCSERDSQFIVKESQDRNDV 612 Query: 85 QN--GAVDKTISHETLAKVESQGPCWDDKE 2 N G +K S ++L + ++Q P D KE Sbjct: 613 HNITGLEEKNASSDSLKEAQTQSPVMDVKE 642