BLASTX nr result
ID: Achyranthes23_contig00039550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00039550 (289 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310535.1| PAD4 [Populus trichocarpa] 61 1e-07 ref|XP_002307052.1| hypothetical protein POPTR_0005s06970g [Popu... 60 3e-07 ref|XP_006380396.1| hypothetical protein POPTR_0007s04680g [Popu... 59 5e-07 >ref|XP_002310535.1| PAD4 [Populus trichocarpa] Length = 536 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = +1 Query: 94 RFETTEMAANFLASTNLLYESWSLCNLAKXXXXXAFVVQQNGPVGLVGLSG 246 RFET+EM A+FLAST LL ESW LCNLA +FVV Q G +G V SG Sbjct: 1 RFETSEMLADFLASTPLLSESWRLCNLATANSPQSFVVDQVGSIGYVAFSG 51 >ref|XP_002307052.1| hypothetical protein POPTR_0005s06970g [Populus trichocarpa] gi|222856501|gb|EEE94048.1| hypothetical protein POPTR_0005s06970g [Populus trichocarpa] Length = 123 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/63 (49%), Positives = 36/63 (57%) Frame = +1 Query: 97 FETTEMAANFLASTNLLYESWSLCNLAKXXXXXAFVVQQNGPVGLVGLSGLHDMGFGSGL 276 FET+EM A FLAST LL ESW LCNLA FV +Q G +G V SG+ + Sbjct: 8 FETSEMLATFLASTPLLPESWRLCNLANANSPQGFVAEQIGSIGYVAFSGIESVSGSDPS 67 Query: 277 FVN 285 F N Sbjct: 68 FKN 70 >ref|XP_006380396.1| hypothetical protein POPTR_0007s04680g [Populus trichocarpa] gi|550334137|gb|ERP58193.1| hypothetical protein POPTR_0007s04680g [Populus trichocarpa] Length = 126 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = +1 Query: 97 FETTEMAANFLASTNLLYESWSLCNLAKXXXXXAFVVQQNGPVGLVGLSG 246 FET+EM A+FLAST LL ESW LCNLA +FVV Q G +G V SG Sbjct: 8 FETSEMLADFLASTPLLSESWRLCNLATANSPQSFVVDQVGSIGYVAFSG 57