BLASTX nr result
ID: Achyranthes23_contig00039044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00039044 (286 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446972.1| hypothetical protein CICLE_v10016821mg [Citr... 56 4e-06 >ref|XP_006446972.1| hypothetical protein CICLE_v10016821mg [Citrus clementina] gi|568829093|ref|XP_006468865.1| PREDICTED: translocon-associated protein subunit beta-like [Citrus sinensis] gi|557549583|gb|ESR60212.1| hypothetical protein CICLE_v10016821mg [Citrus clementina] Length = 194 Score = 56.2 bits (134), Expect = 4e-06 Identities = 36/89 (40%), Positives = 43/89 (48%), Gaps = 33/89 (37%) Frame = -3 Query: 173 AFAFSDAPFIIVHKKESLLCLKYGFEHVIVTIDIYNEGF--------------------- 57 +FA SD PFI+ HKK SL LK G E V V++DIYN+G Sbjct: 22 SFASSDVPFIVAHKKASLKRLKSGAERVSVSVDIYNQGTSTAYDVSLTDDSWPQDKFDVI 81 Query: 56 ------------AGALVSHSFEL*AKVKG 6 AG ++SHSFEL AKVKG Sbjct: 82 SGNISQSWERLDAGGILSHSFELDAKVKG 110