BLASTX nr result
ID: Achyranthes23_contig00038427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00038427 (356 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530046.1| Cysteine desulfuration protein sufE, putativ... 59 9e-07 >ref|XP_002530046.1| Cysteine desulfuration protein sufE, putative [Ricinus communis] gi|223530462|gb|EEF32346.1| Cysteine desulfuration protein sufE, putative [Ricinus communis] Length = 231 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 234 LAVSKFEQLISEFQPLTNPADKIKHLLNYAARLPPLDESNR 356 +AVS+ E+L+SEF+ LT P D++K LL+YAARLPP DES R Sbjct: 23 VAVSRLERLVSEFESLTEPIDRVKRLLDYAARLPPFDESAR 63