BLASTX nr result
ID: Achyranthes23_contig00038296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00038296 (241 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA74900.1| anthranilate synthase alpha subunit [Ruta graveol... 77 2e-12 gb|EXC01464.1| Anthranilate synthase component I-2 [Morus notabi... 76 4e-12 gb|EXB62189.1| Anthranilate synthase component I-2 [Morus notabi... 75 9e-12 gb|EOY33756.1| Anthranilate synthase component I-2 isoform 6 [Th... 75 9e-12 gb|EOY33754.1| Anthranilate synthase component I-2 isoform 4 [Th... 75 9e-12 gb|EOY33753.1| Anthranilate synthase component I-2 isoform 3 [Th... 75 9e-12 gb|EOY33752.1| Anthranilate synthase component I-2 isoform 2 [Th... 75 9e-12 gb|EOY33751.1| Anthranilate synthase 2 isoform 1 [Theobroma cacao] 75 9e-12 emb|CBI15979.3| unnamed protein product [Vitis vinifera] 73 4e-11 gb|AGJ70266.1| anthranilate synthase A [Vitis vinifera] 72 6e-11 ref|XP_004295746.1| PREDICTED: anthranilate synthase component I... 72 6e-11 gb|AFL91701.1| anthranilate synthase alpha-subunit 2 [Mitragyna ... 72 6e-11 ref|XP_006488497.1| PREDICTED: anthranilate synthase component I... 72 1e-10 ref|XP_003555838.1| PREDICTED: anthranilate synthase component I... 71 2e-10 ref|XP_006425048.1| hypothetical protein CICLE_v10028065mg [Citr... 70 3e-10 ref|XP_004144668.1| PREDICTED: anthranilate synthase component I... 70 3e-10 gb|EMJ20148.1| hypothetical protein PRUPE_ppa003426mg [Prunus pe... 69 5e-10 ref|XP_006848166.1| hypothetical protein AMTR_s00029p00234880 [A... 69 6e-10 ref|XP_004240399.1| PREDICTED: anthranilate synthase component I... 69 6e-10 ref|XP_002525623.1| anthranilate synthase component I, putative ... 69 6e-10 >gb|AAA74900.1| anthranilate synthase alpha subunit [Ruta graveolens] Length = 608 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +2 Query: 104 SPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 SPS VDQSA F E SK+GNL+PL +CIFSDHLTPVLAYRCLV E+D Sbjct: 75 SPSLVDQSANFHEASKKGNLIPLYRCIFSDHLTPVLAYRCLVKEDD 120 >gb|EXC01464.1| Anthranilate synthase component I-2 [Morus notabilis] Length = 738 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +2 Query: 92 SVLSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S LSSPS VDQS F E SK+GNL+PL + IFSDHLTPVLAYRCLV E+D Sbjct: 45 SALSSPSLVDQSERFSEASKKGNLIPLYRTIFSDHLTPVLAYRCLVKEDD 94 >gb|EXB62189.1| Anthranilate synthase component I-2 [Morus notabilis] Length = 288 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = +2 Query: 92 SVLSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S LSSPS VDQS F E SK+GNL+PL + IFSDHLTPVLAYRCLV E D Sbjct: 45 SALSSPSLVDQSERFSEASKKGNLIPLYRTIFSDHLTPVLAYRCLVKEAD 94 >gb|EOY33756.1| Anthranilate synthase component I-2 isoform 6 [Theobroma cacao] Length = 515 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/51 (74%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +2 Query: 92 SVLSSPSQ-VDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S LSSPS VDQS F E SK GNLVPL +CIFSDHLTPV+AYRCLV E+D Sbjct: 58 SALSSPSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDD 108 >gb|EOY33754.1| Anthranilate synthase component I-2 isoform 4 [Theobroma cacao] Length = 506 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/51 (74%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +2 Query: 92 SVLSSPSQ-VDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S LSSPS VDQS F E SK GNLVPL +CIFSDHLTPV+AYRCLV E+D Sbjct: 58 SALSSPSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDD 108 >gb|EOY33753.1| Anthranilate synthase component I-2 isoform 3 [Theobroma cacao] Length = 465 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/51 (74%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +2 Query: 92 SVLSSPSQ-VDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S LSSPS VDQS F E SK GNLVPL +CIFSDHLTPV+AYRCLV E+D Sbjct: 58 SALSSPSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDD 108 >gb|EOY33752.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao] gi|508786499|gb|EOY33755.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao] Length = 471 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/51 (74%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +2 Query: 92 SVLSSPSQ-VDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S LSSPS VDQS F E SK GNLVPL +CIFSDHLTPV+AYRCLV E+D Sbjct: 58 SALSSPSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDD 108 >gb|EOY33751.1| Anthranilate synthase 2 isoform 1 [Theobroma cacao] Length = 596 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/51 (74%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +2 Query: 92 SVLSSPSQ-VDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S LSSPS VDQS F E SK GNLVPL +CIFSDHLTPV+AYRCLV E+D Sbjct: 58 SALSSPSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDD 108 >emb|CBI15979.3| unnamed protein product [Vitis vinifera] Length = 589 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 101 SSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 SSPS VD SA F E +K+GNL+PL + IFSDHLTPVLAYRCLV E+D Sbjct: 74 SSPSLVDHSAKFFEAAKKGNLIPLHRSIFSDHLTPVLAYRCLVKEDD 120 >gb|AGJ70266.1| anthranilate synthase A [Vitis vinifera] Length = 608 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 101 SSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 SSPS VD SA F E +K+GNL+PL + IFSDHLTPVLAYRCLV E+D Sbjct: 74 SSPSLVDHSAKFFEAAKKGNLIPLYRSIFSDHLTPVLAYRCLVKEDD 120 >ref|XP_004295746.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 585 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +2 Query: 92 SVLSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S LSSPS +QS F E SK GNL+PL + +FSDHLTPVLAYRCLV E+D Sbjct: 48 SALSSPSLAEQSEKFFEASKNGNLIPLYRSVFSDHLTPVLAYRCLVKEDD 97 >gb|AFL91701.1| anthranilate synthase alpha-subunit 2 [Mitragyna speciosa] Length = 575 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +2 Query: 92 SVLSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S +S PS VDQSA F E +K GNL+PL + IFSDHLTPVLAYRCLV E+D Sbjct: 38 STVSPPSLVDQSAKFKEAAKHGNLIPLYRPIFSDHLTPVLAYRCLVKEDD 87 >ref|XP_006488497.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Citrus sinensis] Length = 596 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/64 (56%), Positives = 43/64 (67%) Frame = +2 Query: 50 SIRQLDHRRRFAVYSVLSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLV 229 S +R R + +S VDQS F E SK+GNL+PL +CIFSDHLTPVLAYRCLV Sbjct: 45 SFTSSSYRARTLTCAASASLLFVDQSEKFQEASKKGNLIPLYRCIFSDHLTPVLAYRCLV 104 Query: 230 NEND 241 E+D Sbjct: 105 KEDD 108 >ref|XP_003555838.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Glycine max] Length = 567 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +2 Query: 104 SPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 SPS VD + F+E SK+GN++PL +CIFSDHLTPVLAYRCLV E++ Sbjct: 35 SPSLVDNAQKFLEASKKGNVIPLFRCIFSDHLTPVLAYRCLVKEDE 80 >ref|XP_006425048.1| hypothetical protein CICLE_v10028065mg [Citrus clementina] gi|557526982|gb|ESR38288.1| hypothetical protein CICLE_v10028065mg [Citrus clementina] Length = 596 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/64 (56%), Positives = 42/64 (65%) Frame = +2 Query: 50 SIRQLDHRRRFAVYSVLSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLV 229 S +R R + +S VDQ A F E SK GNL+PL +CIFSDHLTPVLAYRCLV Sbjct: 45 SFTSSSYRARTLTCAASASLLFVDQLAKFQEASKTGNLIPLYRCIFSDHLTPVLAYRCLV 104 Query: 230 NEND 241 E+D Sbjct: 105 KEDD 108 >ref|XP_004144668.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Cucumis sativus] gi|449502526|ref|XP_004161666.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Cucumis sativus] Length = 588 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +2 Query: 101 SSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S+ S VD F+E SK+GNL+PL +CIFSDHL+PVLAYRCLV E+D Sbjct: 54 SAASLVDSPEAFIEASKKGNLIPLHRCIFSDHLSPVLAYRCLVKEDD 100 >gb|EMJ20148.1| hypothetical protein PRUPE_ppa003426mg [Prunus persica] Length = 575 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 LSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 LS+ S + F E SK+GNLVPLS+CIFSDHLTPVLAYRCLV E+D Sbjct: 44 LSNQSLANDVKKFEEASKKGNLVPLSKCIFSDHLTPVLAYRCLVKEDD 91 >ref|XP_006848166.1| hypothetical protein AMTR_s00029p00234880 [Amborella trichopoda] gi|548851471|gb|ERN09747.1| hypothetical protein AMTR_s00029p00234880 [Amborella trichopoda] Length = 579 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +2 Query: 101 SSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 +S + VD +A F+E SK+GNLVPL +CIFSDHLTPVLAYRCLV E+D Sbjct: 46 TSTASVD-AAKFIEASKKGNLVPLYRCIFSDHLTPVLAYRCLVKEDD 91 >ref|XP_004240399.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Solanum lycopersicum] Length = 587 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +2 Query: 92 SVLSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 + +S PS VD S F E +K GNL+PL + IFSDHLTPVLAYRCLV E+D Sbjct: 50 AAISPPSLVDDSVKFKEAAKHGNLIPLYRSIFSDHLTPVLAYRCLVKEDD 99 >ref|XP_002525623.1| anthranilate synthase component I, putative [Ricinus communis] gi|223535059|gb|EEF36741.1| anthranilate synthase component I, putative [Ricinus communis] Length = 614 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +2 Query: 92 SVLSSPSQVDQSATFVEKSKRGNLVPLSQCIFSDHLTPVLAYRCLVNEND 241 S +S + DQSA F E SK+GNLVPL CI DHLTPVLAYRCLV E+D Sbjct: 77 SASTSQAYADQSAKFQEASKKGNLVPLYHCILCDHLTPVLAYRCLVKEDD 126