BLASTX nr result
ID: Achyranthes23_contig00038213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00038213 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW32026.1| hypothetical protein PHAVU_002G286900g [Phaseolus... 55 7e-06 >gb|ESW32026.1| hypothetical protein PHAVU_002G286900g [Phaseolus vulgaris] Length = 146 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 279 ASMDPYIILTCRTQERKSTVSTDNGSNPEWN 371 A+MDPY+I TCRTQE+KS+V+T GSNP+WN Sbjct: 23 ANMDPYVIFTCRTQEQKSSVATGKGSNPKWN 53