BLASTX nr result
ID: Achyranthes23_contig00038062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00038062 (938 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528398.1| conserved hypothetical protein [Ricinus comm... 59 3e-06 >ref|XP_002528398.1| conserved hypothetical protein [Ricinus communis] gi|223532186|gb|EEF33991.1| conserved hypothetical protein [Ricinus communis] Length = 342 Score = 58.5 bits (140), Expect = 3e-06 Identities = 29/71 (40%), Positives = 39/71 (54%), Gaps = 4/71 (5%) Frame = +3 Query: 657 DNEIGVYCCLCERDMGVEPSQDDKSEQSLTTLRVAAILPCGHAFHVDCL----YNDELEL 824 DN +G CCLCE+D+ P + E AAILPCGH FH+ CL + +EL+ Sbjct: 274 DNRVGYICCLCEKDLAYPPMPPE-IELEFQRFPDAAILPCGHTFHLQCLELAVHEEELK- 331 Query: 825 KPGGEPSCIIC 857 +P+C IC Sbjct: 332 ----DPTCFIC 338